Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RD80

Protein Details
Accession G2RD80   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-54TSQDPERQAAKRKRSREKPSKPSKLSQPRKPSKTSHydrophilic
NLS Segment(s)
PositionSequence
28-51AAKRKRSREKPSKPSKLSQPRKPS
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG ttt:THITE_2120677  -  
Amino Acid Sequences MKQSRPSNTEPGPWLGSSHTSQDPERQAAKRKRSREKPSKPSKLSQPRKPSKTSQNTTAKPSPVSIPLSLPVLAWFPARPGPRFVVLRAAEGLELPTCATWQCHKIVSGGTRIRRHSSRALAKKLGLSLSRSLPADHADHVCSRLRPSLLSKSRHVPDFDWLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.29
4 0.25
5 0.26
6 0.25
7 0.26
8 0.27
9 0.33
10 0.35
11 0.36
12 0.41
13 0.41
14 0.48
15 0.54
16 0.64
17 0.66
18 0.71
19 0.77
20 0.81
21 0.87
22 0.88
23 0.9
24 0.9
25 0.92
26 0.93
27 0.88
28 0.84
29 0.84
30 0.83
31 0.82
32 0.81
33 0.81
34 0.8
35 0.81
36 0.79
37 0.76
38 0.76
39 0.77
40 0.72
41 0.7
42 0.7
43 0.67
44 0.69
45 0.66
46 0.57
47 0.46
48 0.43
49 0.35
50 0.29
51 0.28
52 0.21
53 0.18
54 0.17
55 0.17
56 0.16
57 0.14
58 0.11
59 0.09
60 0.09
61 0.08
62 0.07
63 0.07
64 0.12
65 0.13
66 0.14
67 0.16
68 0.17
69 0.21
70 0.22
71 0.21
72 0.24
73 0.23
74 0.23
75 0.21
76 0.19
77 0.15
78 0.14
79 0.14
80 0.06
81 0.06
82 0.05
83 0.04
84 0.04
85 0.05
86 0.06
87 0.08
88 0.1
89 0.12
90 0.14
91 0.14
92 0.15
93 0.19
94 0.2
95 0.26
96 0.29
97 0.34
98 0.38
99 0.4
100 0.45
101 0.43
102 0.46
103 0.44
104 0.48
105 0.52
106 0.55
107 0.59
108 0.57
109 0.56
110 0.54
111 0.49
112 0.43
113 0.35
114 0.29
115 0.26
116 0.25
117 0.27
118 0.25
119 0.24
120 0.21
121 0.22
122 0.21
123 0.2
124 0.19
125 0.19
126 0.19
127 0.21
128 0.24
129 0.23
130 0.24
131 0.26
132 0.25
133 0.26
134 0.31
135 0.4
136 0.44
137 0.48
138 0.5
139 0.53
140 0.58
141 0.6
142 0.57
143 0.48
144 0.47