Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QY19

Protein Details
Accession G2QY19    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
333-353AAAAGGKKRHWLKRRWPIGGLHydrophilic
NLS Segment(s)
PositionSequence
339-346KKRHWLKR
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040165  Diminuto-like  
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2109850  -  
Amino Acid Sequences MGARMRRGRVRGGGGICFGVPAGAVGTLGLTTLLEIRLMQARRFVKTRYRRTGSVAEAVEAVREEVRRPGVDYVDGILFSKDHGVVVTGELTDEMPEGARPQTFSGPWDPWFYLHAREKTAAVAAGTDSAPVDYVPLAEYLFRYDRGGFWVGAAAFEYFKLVPFNRFFRWFLDDFLHTRMMYRALHGSGESARFVVQDVAMPFETTERFVDYTSSELGIWPLWLCPLKRRAPPTFHPFTTLPEGVDRKEDDLMLNVGVWGWGPSDPAEFVRKNRELEHKVRELGGMKWLYAHTYYPQDEFWPMYGGRGWYDALRAKYHAETLPTVWDKVHVDAAAAGGKKRHWLKRRWPIGGLYGIYKSIQSKDYMLHRHAKWKWKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.35
4 0.27
5 0.21
6 0.13
7 0.09
8 0.07
9 0.06
10 0.05
11 0.05
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.06
20 0.06
21 0.06
22 0.06
23 0.08
24 0.15
25 0.18
26 0.18
27 0.25
28 0.28
29 0.33
30 0.36
31 0.39
32 0.43
33 0.51
34 0.61
35 0.64
36 0.68
37 0.65
38 0.69
39 0.71
40 0.65
41 0.62
42 0.52
43 0.42
44 0.37
45 0.34
46 0.28
47 0.2
48 0.16
49 0.11
50 0.11
51 0.11
52 0.14
53 0.18
54 0.18
55 0.2
56 0.22
57 0.22
58 0.23
59 0.22
60 0.2
61 0.17
62 0.17
63 0.15
64 0.12
65 0.1
66 0.09
67 0.11
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.09
74 0.1
75 0.08
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.07
85 0.08
86 0.08
87 0.09
88 0.11
89 0.14
90 0.15
91 0.17
92 0.21
93 0.22
94 0.23
95 0.26
96 0.24
97 0.21
98 0.23
99 0.22
100 0.25
101 0.3
102 0.31
103 0.29
104 0.3
105 0.3
106 0.28
107 0.28
108 0.21
109 0.13
110 0.11
111 0.08
112 0.09
113 0.08
114 0.08
115 0.06
116 0.06
117 0.06
118 0.05
119 0.06
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.09
128 0.1
129 0.1
130 0.11
131 0.11
132 0.12
133 0.15
134 0.17
135 0.14
136 0.12
137 0.14
138 0.13
139 0.12
140 0.12
141 0.09
142 0.07
143 0.07
144 0.08
145 0.05
146 0.06
147 0.09
148 0.09
149 0.13
150 0.16
151 0.19
152 0.21
153 0.25
154 0.25
155 0.25
156 0.3
157 0.26
158 0.25
159 0.24
160 0.23
161 0.21
162 0.23
163 0.22
164 0.16
165 0.16
166 0.15
167 0.15
168 0.13
169 0.13
170 0.12
171 0.11
172 0.12
173 0.11
174 0.11
175 0.1
176 0.11
177 0.1
178 0.08
179 0.07
180 0.07
181 0.08
182 0.07
183 0.06
184 0.07
185 0.07
186 0.09
187 0.09
188 0.09
189 0.08
190 0.09
191 0.09
192 0.08
193 0.09
194 0.08
195 0.08
196 0.09
197 0.1
198 0.09
199 0.1
200 0.09
201 0.1
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07
207 0.06
208 0.05
209 0.06
210 0.09
211 0.09
212 0.14
213 0.22
214 0.28
215 0.33
216 0.4
217 0.44
218 0.49
219 0.56
220 0.59
221 0.58
222 0.52
223 0.52
224 0.46
225 0.43
226 0.43
227 0.36
228 0.28
229 0.26
230 0.27
231 0.23
232 0.25
233 0.22
234 0.17
235 0.17
236 0.17
237 0.13
238 0.13
239 0.13
240 0.1
241 0.1
242 0.08
243 0.07
244 0.06
245 0.06
246 0.04
247 0.04
248 0.04
249 0.05
250 0.06
251 0.07
252 0.08
253 0.1
254 0.15
255 0.16
256 0.19
257 0.27
258 0.31
259 0.32
260 0.37
261 0.45
262 0.46
263 0.52
264 0.57
265 0.53
266 0.5
267 0.49
268 0.46
269 0.38
270 0.32
271 0.32
272 0.25
273 0.2
274 0.2
275 0.2
276 0.19
277 0.18
278 0.18
279 0.14
280 0.2
281 0.21
282 0.21
283 0.22
284 0.21
285 0.22
286 0.22
287 0.2
288 0.17
289 0.16
290 0.16
291 0.17
292 0.16
293 0.16
294 0.16
295 0.16
296 0.12
297 0.17
298 0.21
299 0.22
300 0.23
301 0.24
302 0.25
303 0.26
304 0.29
305 0.27
306 0.25
307 0.24
308 0.23
309 0.31
310 0.3
311 0.29
312 0.25
313 0.26
314 0.25
315 0.25
316 0.27
317 0.18
318 0.17
319 0.17
320 0.18
321 0.19
322 0.18
323 0.17
324 0.15
325 0.16
326 0.24
327 0.32
328 0.41
329 0.46
330 0.55
331 0.65
332 0.74
333 0.83
334 0.81
335 0.77
336 0.71
337 0.68
338 0.65
339 0.55
340 0.47
341 0.38
342 0.33
343 0.3
344 0.27
345 0.23
346 0.2
347 0.21
348 0.2
349 0.21
350 0.26
351 0.34
352 0.4
353 0.43
354 0.48
355 0.49
356 0.57
357 0.62
358 0.67