Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2R822

Protein Details
Accession G2R822    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28ASRGRSGKFRKYTRGGGKHFBasic
NLS Segment(s)
PositionSequence
13-19RSGKFRK
92-110ERKKEKKARKEAAIAKAKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
IPR039876  HAP28  
KEGG ttt:THITE_2117438  -  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MAGGGPGAASRGRSGKFRKYTRGGGKHFSRDLQPRDADGNEVSMWSEDAVRQLGASDEDEEESEEEESEEESEAEAGGAGPSTTATALSREERKKEKKARKEAAIAKAKKQVQVGDLPPSESEEESEEDDLPANPNHSRQARNQTKPSSVDEAAEGVGKLSVAPSRREREAMEAQAAKERYRKLHEAGKTDEAKADLARLKIIRERREAEAARKQVCCLRFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.51
4 0.57
5 0.64
6 0.66
7 0.74
8 0.77
9 0.81
10 0.76
11 0.75
12 0.75
13 0.74
14 0.7
15 0.62
16 0.59
17 0.58
18 0.58
19 0.56
20 0.5
21 0.44
22 0.45
23 0.42
24 0.37
25 0.28
26 0.25
27 0.18
28 0.17
29 0.14
30 0.11
31 0.11
32 0.09
33 0.09
34 0.07
35 0.08
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.09
50 0.09
51 0.07
52 0.07
53 0.06
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.05
74 0.07
75 0.11
76 0.18
77 0.21
78 0.26
79 0.35
80 0.42
81 0.5
82 0.59
83 0.66
84 0.69
85 0.77
86 0.79
87 0.76
88 0.78
89 0.75
90 0.74
91 0.74
92 0.65
93 0.58
94 0.57
95 0.53
96 0.47
97 0.41
98 0.33
99 0.25
100 0.28
101 0.26
102 0.25
103 0.23
104 0.21
105 0.2
106 0.2
107 0.18
108 0.13
109 0.13
110 0.09
111 0.1
112 0.1
113 0.11
114 0.1
115 0.09
116 0.1
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.1
123 0.16
124 0.19
125 0.22
126 0.26
127 0.37
128 0.45
129 0.51
130 0.58
131 0.56
132 0.57
133 0.57
134 0.55
135 0.5
136 0.41
137 0.35
138 0.28
139 0.24
140 0.2
141 0.17
142 0.13
143 0.07
144 0.07
145 0.06
146 0.05
147 0.05
148 0.08
149 0.09
150 0.14
151 0.21
152 0.25
153 0.27
154 0.3
155 0.3
156 0.35
157 0.39
158 0.38
159 0.37
160 0.35
161 0.34
162 0.38
163 0.38
164 0.32
165 0.31
166 0.31
167 0.31
168 0.36
169 0.4
170 0.38
171 0.45
172 0.5
173 0.51
174 0.53
175 0.55
176 0.51
177 0.48
178 0.45
179 0.38
180 0.33
181 0.27
182 0.26
183 0.22
184 0.2
185 0.24
186 0.23
187 0.25
188 0.3
189 0.38
190 0.41
191 0.44
192 0.48
193 0.48
194 0.57
195 0.58
196 0.6
197 0.62
198 0.62
199 0.6
200 0.57
201 0.55
202 0.51