Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2QZJ6

Protein Details
Accession G2QZJ6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
260-281PDSSRWRQPRPPASTPRPRPTPHydrophilic
NLS Segment(s)
PositionSequence
317-323KAEKPPH
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
KEGG ttt:THITE_2095021  -  
Amino Acid Sequences MENHGLVVRKLEDKDSQSLRDWADRAAMVKAKLAKLDGPALRGILGREYHDIFGALTYRPAGARPPVPMEELEEPDDDTRRCSAAESRTPTQPNTMASSARCPRGSSCRSDTDTQQLLKTSAHDSRAWSRPDHASPSARHAVNDPNNPKPPLTPAASSPSETSPGYQLFAAELGQRLRKLQSFTTPESVQASIRKRWQALSAQDRQYYDAKAARMRSSAVPFDPRQDRLPLSPKASPNPPLPLTQPAARSTPRDGGHAVPDSSRWRQPRPPASTPRPRPTPYAAAAAAKPPPSRALAPVSSSRLNSAASRGVQPRIKAEKPPHGTSSRGAKGKAVGVIDLTGGSQARIKAEKLPHGTSSRGGRRKAVEVVDLTGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.45
4 0.43
5 0.47
6 0.46
7 0.45
8 0.42
9 0.34
10 0.33
11 0.3
12 0.28
13 0.29
14 0.3
15 0.24
16 0.28
17 0.32
18 0.3
19 0.3
20 0.3
21 0.28
22 0.27
23 0.34
24 0.31
25 0.28
26 0.27
27 0.26
28 0.25
29 0.24
30 0.21
31 0.18
32 0.17
33 0.18
34 0.21
35 0.22
36 0.22
37 0.21
38 0.2
39 0.16
40 0.16
41 0.15
42 0.12
43 0.1
44 0.1
45 0.11
46 0.11
47 0.11
48 0.13
49 0.17
50 0.19
51 0.22
52 0.26
53 0.27
54 0.29
55 0.28
56 0.3
57 0.29
58 0.29
59 0.27
60 0.23
61 0.22
62 0.22
63 0.25
64 0.2
65 0.18
66 0.17
67 0.15
68 0.15
69 0.16
70 0.21
71 0.26
72 0.34
73 0.39
74 0.41
75 0.47
76 0.5
77 0.48
78 0.46
79 0.41
80 0.35
81 0.33
82 0.32
83 0.27
84 0.26
85 0.33
86 0.34
87 0.36
88 0.34
89 0.3
90 0.32
91 0.4
92 0.43
93 0.41
94 0.42
95 0.44
96 0.47
97 0.49
98 0.47
99 0.45
100 0.46
101 0.41
102 0.37
103 0.31
104 0.28
105 0.26
106 0.25
107 0.21
108 0.19
109 0.21
110 0.21
111 0.23
112 0.29
113 0.35
114 0.35
115 0.32
116 0.32
117 0.35
118 0.37
119 0.39
120 0.36
121 0.34
122 0.34
123 0.39
124 0.43
125 0.37
126 0.35
127 0.31
128 0.36
129 0.37
130 0.45
131 0.41
132 0.41
133 0.45
134 0.46
135 0.44
136 0.36
137 0.34
138 0.3
139 0.29
140 0.24
141 0.22
142 0.27
143 0.27
144 0.27
145 0.25
146 0.21
147 0.2
148 0.19
149 0.17
150 0.14
151 0.13
152 0.13
153 0.11
154 0.11
155 0.08
156 0.09
157 0.08
158 0.06
159 0.07
160 0.08
161 0.1
162 0.1
163 0.11
164 0.12
165 0.14
166 0.16
167 0.16
168 0.23
169 0.26
170 0.29
171 0.32
172 0.31
173 0.29
174 0.28
175 0.27
176 0.21
177 0.21
178 0.22
179 0.22
180 0.26
181 0.28
182 0.26
183 0.27
184 0.29
185 0.3
186 0.33
187 0.38
188 0.41
189 0.42
190 0.43
191 0.42
192 0.41
193 0.37
194 0.3
195 0.25
196 0.21
197 0.19
198 0.2
199 0.22
200 0.21
201 0.2
202 0.22
203 0.22
204 0.22
205 0.22
206 0.21
207 0.24
208 0.23
209 0.28
210 0.3
211 0.29
212 0.28
213 0.29
214 0.29
215 0.29
216 0.35
217 0.33
218 0.34
219 0.36
220 0.37
221 0.38
222 0.4
223 0.39
224 0.35
225 0.37
226 0.35
227 0.32
228 0.31
229 0.32
230 0.31
231 0.3
232 0.3
233 0.26
234 0.28
235 0.28
236 0.28
237 0.27
238 0.31
239 0.29
240 0.28
241 0.27
242 0.26
243 0.29
244 0.29
245 0.26
246 0.19
247 0.22
248 0.24
249 0.27
250 0.31
251 0.3
252 0.33
253 0.4
254 0.49
255 0.56
256 0.6
257 0.66
258 0.7
259 0.75
260 0.81
261 0.83
262 0.82
263 0.8
264 0.73
265 0.69
266 0.65
267 0.62
268 0.54
269 0.5
270 0.43
271 0.37
272 0.35
273 0.33
274 0.3
275 0.27
276 0.24
277 0.2
278 0.21
279 0.22
280 0.23
281 0.23
282 0.27
283 0.25
284 0.29
285 0.32
286 0.35
287 0.34
288 0.32
289 0.31
290 0.26
291 0.25
292 0.22
293 0.21
294 0.21
295 0.21
296 0.26
297 0.28
298 0.33
299 0.35
300 0.35
301 0.41
302 0.44
303 0.46
304 0.48
305 0.53
306 0.57
307 0.61
308 0.65
309 0.62
310 0.57
311 0.56
312 0.53
313 0.56
314 0.53
315 0.5
316 0.45
317 0.41
318 0.41
319 0.42
320 0.41
321 0.31
322 0.24
323 0.21
324 0.2
325 0.18
326 0.15
327 0.11
328 0.09
329 0.08
330 0.08
331 0.1
332 0.11
333 0.15
334 0.18
335 0.19
336 0.25
337 0.31
338 0.4
339 0.43
340 0.46
341 0.48
342 0.49
343 0.5
344 0.48
345 0.52
346 0.54
347 0.55
348 0.54
349 0.54
350 0.56
351 0.59
352 0.6
353 0.53
354 0.49
355 0.44
356 0.43