Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RFQ1

Protein Details
Accession G2RFQ1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-65PTGVLLTRVRKKPKPQTCPNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, nucl 11.5, cyto_nucl 8.833, cyto_mito 8.499
Family & Domain DBs
KEGG ttt:THITE_49533  -  
Amino Acid Sequences MHGTSCPKCGAASDGVSKTCGSCGAVSSPCRVHRTYLPHGSVDPIPTGVLLTRVRKKPKPQTCPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.26
5 0.22
6 0.19
7 0.16
8 0.11
9 0.09
10 0.1
11 0.12
12 0.16
13 0.17
14 0.19
15 0.22
16 0.24
17 0.26
18 0.26
19 0.24
20 0.26
21 0.32
22 0.37
23 0.41
24 0.39
25 0.37
26 0.36
27 0.37
28 0.33
29 0.26
30 0.19
31 0.12
32 0.11
33 0.1
34 0.1
35 0.08
36 0.11
37 0.14
38 0.21
39 0.29
40 0.37
41 0.46
42 0.54
43 0.64
44 0.71
45 0.77