Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2RDK4

Protein Details
Accession G2RDK4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
157-182PIIKHMVKCRYCRKRINEKALRCVNCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 5, cyto 3.5, cyto_nucl 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037673  MSC/AndL  
IPR036019  MscL_channel  
IPR003656  Znf_BED  
Gene Ontology GO:0016020  C:membrane  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
KEGG ttt:THITE_130699  -  
Pfam View protein in Pfam  
PF02892  zf-BED  
Amino Acid Sequences MPRLPLTPDRPPSSTASSINADDPDTRPLLDESRQRASHFLQGFADFALPGATCWRSRSGWCWRPCSRRCNGDVAGQRRAAAAAVGAAAAEPQPGGREKFAVLRPGPNAGGHREGARDDGAVVMAYGVFLNRLLNFMGVGFSLYGLAAVYQYFSRDPIIKHMVKCRYCRKRINEKALRCVNCSSWQDGREDLQPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.42
3 0.38
4 0.36
5 0.35
6 0.34
7 0.3
8 0.25
9 0.22
10 0.22
11 0.21
12 0.19
13 0.18
14 0.17
15 0.18
16 0.2
17 0.24
18 0.29
19 0.31
20 0.38
21 0.39
22 0.39
23 0.4
24 0.4
25 0.42
26 0.37
27 0.33
28 0.27
29 0.26
30 0.25
31 0.22
32 0.19
33 0.11
34 0.09
35 0.08
36 0.06
37 0.06
38 0.08
39 0.1
40 0.1
41 0.12
42 0.16
43 0.16
44 0.18
45 0.25
46 0.33
47 0.4
48 0.45
49 0.51
50 0.56
51 0.64
52 0.69
53 0.7
54 0.65
55 0.64
56 0.61
57 0.6
58 0.54
59 0.52
60 0.54
61 0.51
62 0.49
63 0.41
64 0.39
65 0.32
66 0.3
67 0.22
68 0.13
69 0.09
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.02
80 0.04
81 0.05
82 0.06
83 0.07
84 0.07
85 0.08
86 0.13
87 0.15
88 0.2
89 0.19
90 0.2
91 0.21
92 0.22
93 0.22
94 0.19
95 0.18
96 0.16
97 0.17
98 0.15
99 0.15
100 0.14
101 0.14
102 0.14
103 0.13
104 0.1
105 0.08
106 0.07
107 0.07
108 0.06
109 0.05
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.04
137 0.05
138 0.06
139 0.07
140 0.08
141 0.1
142 0.14
143 0.15
144 0.21
145 0.3
146 0.33
147 0.36
148 0.44
149 0.51
150 0.54
151 0.62
152 0.66
153 0.68
154 0.72
155 0.78
156 0.8
157 0.82
158 0.86
159 0.89
160 0.88
161 0.85
162 0.86
163 0.86
164 0.79
165 0.71
166 0.64
167 0.57
168 0.55
169 0.51
170 0.47
171 0.44
172 0.42
173 0.41
174 0.4
175 0.39