Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R2Y0

Protein Details
Accession G2R2Y0   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
251-274ATTQSKPTRATKKKRTTIPPTTLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, extr 6, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ttt:THITE_2113486  -  
Amino Acid Sequences MPASFIVGHPATQGGATSSQEEYDETESEEDRVLTSSTEAIHPSASLARQRSAERAVLDTDSDESDGDENATALGRPSNAPVFRPQPNAFSNPPSHLTHRHSTGSAPYSHHPSHAARPHARSHRGHPNYMSPSYQADNDAALRTSLTTLLSCAAAARGLPKQDEKRNAPGAGAGVVPSSQPMELRLVPESELMADVPPPASGPSSGVPPKAPQTAKTTTTSRTASNSSAPSAPSSNSGREQPDQEKTKRAATTQSKPTRATKKKRTTIPPTTLLGGGAAAEPASPETDTAFPFFMISPTLLTWVVSAGVVVLVSVVGFGAGYVIGREVGRQEGGAATAANAWGGGAAAANASSGCGSEVLRAGASSSTAASAAAAAGAVAGGTGTLRRIRWGGVGKSVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.15
5 0.14
6 0.15
7 0.15
8 0.15
9 0.16
10 0.17
11 0.16
12 0.15
13 0.17
14 0.17
15 0.17
16 0.18
17 0.15
18 0.12
19 0.13
20 0.12
21 0.11
22 0.11
23 0.12
24 0.12
25 0.13
26 0.14
27 0.13
28 0.13
29 0.13
30 0.13
31 0.15
32 0.17
33 0.21
34 0.23
35 0.26
36 0.29
37 0.31
38 0.34
39 0.35
40 0.35
41 0.31
42 0.3
43 0.29
44 0.27
45 0.25
46 0.21
47 0.18
48 0.15
49 0.14
50 0.12
51 0.1
52 0.1
53 0.1
54 0.09
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.12
65 0.18
66 0.19
67 0.21
68 0.26
69 0.31
70 0.35
71 0.42
72 0.4
73 0.4
74 0.42
75 0.46
76 0.42
77 0.42
78 0.4
79 0.36
80 0.39
81 0.37
82 0.37
83 0.39
84 0.42
85 0.42
86 0.44
87 0.43
88 0.39
89 0.37
90 0.39
91 0.35
92 0.32
93 0.3
94 0.28
95 0.33
96 0.32
97 0.32
98 0.3
99 0.29
100 0.35
101 0.38
102 0.44
103 0.41
104 0.45
105 0.52
106 0.57
107 0.61
108 0.56
109 0.56
110 0.59
111 0.59
112 0.58
113 0.52
114 0.52
115 0.51
116 0.49
117 0.43
118 0.33
119 0.32
120 0.29
121 0.27
122 0.2
123 0.15
124 0.14
125 0.14
126 0.13
127 0.11
128 0.1
129 0.09
130 0.08
131 0.08
132 0.07
133 0.07
134 0.06
135 0.06
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.07
144 0.08
145 0.09
146 0.11
147 0.17
148 0.23
149 0.3
150 0.38
151 0.4
152 0.45
153 0.48
154 0.47
155 0.42
156 0.36
157 0.3
158 0.23
159 0.18
160 0.11
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.04
167 0.04
168 0.05
169 0.08
170 0.09
171 0.1
172 0.11
173 0.11
174 0.11
175 0.12
176 0.1
177 0.08
178 0.07
179 0.06
180 0.05
181 0.05
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.06
190 0.07
191 0.11
192 0.12
193 0.13
194 0.13
195 0.14
196 0.16
197 0.21
198 0.21
199 0.2
200 0.25
201 0.29
202 0.31
203 0.33
204 0.33
205 0.29
206 0.33
207 0.32
208 0.27
209 0.25
210 0.25
211 0.23
212 0.24
213 0.23
214 0.2
215 0.2
216 0.19
217 0.18
218 0.16
219 0.15
220 0.16
221 0.17
222 0.18
223 0.18
224 0.21
225 0.23
226 0.24
227 0.28
228 0.28
229 0.34
230 0.38
231 0.39
232 0.42
233 0.41
234 0.45
235 0.42
236 0.39
237 0.4
238 0.41
239 0.48
240 0.52
241 0.58
242 0.56
243 0.57
244 0.64
245 0.66
246 0.68
247 0.7
248 0.71
249 0.73
250 0.78
251 0.83
252 0.85
253 0.84
254 0.84
255 0.8
256 0.74
257 0.65
258 0.59
259 0.5
260 0.4
261 0.3
262 0.2
263 0.13
264 0.08
265 0.06
266 0.04
267 0.04
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.07
274 0.09
275 0.1
276 0.11
277 0.11
278 0.1
279 0.11
280 0.11
281 0.1
282 0.09
283 0.09
284 0.08
285 0.08
286 0.1
287 0.09
288 0.09
289 0.09
290 0.08
291 0.08
292 0.07
293 0.06
294 0.04
295 0.04
296 0.04
297 0.04
298 0.03
299 0.03
300 0.02
301 0.03
302 0.02
303 0.02
304 0.02
305 0.02
306 0.02
307 0.02
308 0.03
309 0.03
310 0.04
311 0.05
312 0.05
313 0.06
314 0.07
315 0.09
316 0.1
317 0.09
318 0.1
319 0.09
320 0.1
321 0.1
322 0.09
323 0.07
324 0.08
325 0.08
326 0.07
327 0.06
328 0.05
329 0.04
330 0.04
331 0.04
332 0.03
333 0.03
334 0.03
335 0.03
336 0.04
337 0.04
338 0.04
339 0.04
340 0.04
341 0.05
342 0.06
343 0.06
344 0.09
345 0.11
346 0.11
347 0.12
348 0.11
349 0.12
350 0.11
351 0.12
352 0.1
353 0.09
354 0.08
355 0.08
356 0.08
357 0.07
358 0.07
359 0.06
360 0.05
361 0.04
362 0.04
363 0.03
364 0.03
365 0.03
366 0.02
367 0.02
368 0.02
369 0.03
370 0.04
371 0.06
372 0.1
373 0.11
374 0.15
375 0.16
376 0.18
377 0.26
378 0.34
379 0.35
380 0.4