Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2RB85

Protein Details
Accession G2RB85    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-93IQRINSKQRHYRRRSDRQRSDSQRSDRQRSDRQRSDSQRSDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG ttt:THITE_2090565  -  
Amino Acid Sequences MAVRQIIRLRYNNLTALQEELVKLFPNGDFDVEIVMGQITLTLPRELLPEEIQRINSKQRHYRRRSDRQRSDSQRSDRQRSDRQRSDSQRSDRQRSDSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.29
4 0.25
5 0.21
6 0.17
7 0.15
8 0.13
9 0.12
10 0.11
11 0.09
12 0.09
13 0.11
14 0.11
15 0.11
16 0.11
17 0.1
18 0.11
19 0.1
20 0.09
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.03
27 0.04
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.07
34 0.09
35 0.1
36 0.11
37 0.13
38 0.14
39 0.15
40 0.15
41 0.17
42 0.23
43 0.26
44 0.3
45 0.36
46 0.46
47 0.56
48 0.61
49 0.69
50 0.72
51 0.79
52 0.85
53 0.87
54 0.88
55 0.85
56 0.89
57 0.88
58 0.86
59 0.84
60 0.8
61 0.79
62 0.77
63 0.77
64 0.74
65 0.73
66 0.75
67 0.76
68 0.79
69 0.78
70 0.77
71 0.79
72 0.81
73 0.82
74 0.8
75 0.77
76 0.76
77 0.76
78 0.77
79 0.72