Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2R8M2

Protein Details
Accession G2R8M2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-86GQHPLRPRPFRPQPLRPRPCRPRSCRHSPCRHSPRBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG ttt:THITE_2170542  -  
Amino Acid Sequences MSDSDKCTPSECGLFVGRCRADTPASPPAGLDSDDRQSVAIKVESEAEADSGQHPLRPRPFRPQPLRPRPCRPRSCRHSPCRHSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.3
4 0.27
5 0.25
6 0.26
7 0.25
8 0.23
9 0.23
10 0.28
11 0.27
12 0.27
13 0.26
14 0.25
15 0.24
16 0.23
17 0.22
18 0.17
19 0.13
20 0.14
21 0.14
22 0.14
23 0.13
24 0.12
25 0.12
26 0.12
27 0.1
28 0.09
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.08
40 0.09
41 0.11
42 0.16
43 0.25
44 0.31
45 0.34
46 0.42
47 0.52
48 0.6
49 0.68
50 0.73
51 0.76
52 0.81
53 0.88
54 0.86
55 0.87
56 0.87
57 0.89
58 0.89
59 0.86
60 0.86
61 0.85
62 0.88
63 0.88
64 0.88
65 0.88
66 0.86