Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2R0B4

Protein Details
Accession G2R0B4   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-32PSATPQPQLKKKASFRDRLKAWQKPRQPLEVHydrophilic
261-281SPAPQPQQRPQRQAQPRRLPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
KEGG ttt:THITE_2170527  -  
Amino Acid Sequences MPSATPQPQLKKKASFRDRLKAWQKPRQPLEVLAEESKPRFVYEPKHAAADFSRLAVSPLSPTRQRLPAAMWPVEDDTVEATGRIPQRRDSTPRVRRHSYALAEEPFHAANGAAHVPVASRPVAWSPAADRAAQGGHDQASQTLSDYELFIARAEAEDRERRERVLRSISQRSPPSVRPDPHRQFATAAGSASVDRSSGSSNSRSRFVLSDGSAGMPTHQPHQPQQQHHRGHGRRSSWDPEYATASASVGAEKVPEKMRSSPAPQPQQRPQRQAQPRRLPEPAQNLSQPVAYGADAAFGNTSPPPRTLRRQASLTKRIAEYIRPPKTAMRQIETLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.82
5 0.8
6 0.81
7 0.82
8 0.8
9 0.81
10 0.8
11 0.8
12 0.8
13 0.81
14 0.78
15 0.71
16 0.66
17 0.64
18 0.59
19 0.55
20 0.47
21 0.43
22 0.39
23 0.37
24 0.34
25 0.27
26 0.23
27 0.22
28 0.24
29 0.29
30 0.36
31 0.43
32 0.42
33 0.45
34 0.44
35 0.43
36 0.4
37 0.38
38 0.29
39 0.21
40 0.21
41 0.17
42 0.18
43 0.16
44 0.15
45 0.14
46 0.17
47 0.21
48 0.24
49 0.27
50 0.31
51 0.36
52 0.37
53 0.34
54 0.35
55 0.37
56 0.4
57 0.38
58 0.33
59 0.3
60 0.3
61 0.28
62 0.23
63 0.16
64 0.11
65 0.11
66 0.1
67 0.08
68 0.07
69 0.12
70 0.17
71 0.21
72 0.22
73 0.26
74 0.31
75 0.38
76 0.45
77 0.49
78 0.55
79 0.6
80 0.69
81 0.71
82 0.71
83 0.66
84 0.66
85 0.64
86 0.57
87 0.53
88 0.48
89 0.42
90 0.38
91 0.37
92 0.32
93 0.24
94 0.2
95 0.15
96 0.09
97 0.08
98 0.08
99 0.08
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.08
106 0.07
107 0.06
108 0.07
109 0.08
110 0.11
111 0.1
112 0.11
113 0.11
114 0.17
115 0.18
116 0.17
117 0.16
118 0.15
119 0.15
120 0.15
121 0.14
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.07
131 0.07
132 0.06
133 0.07
134 0.07
135 0.06
136 0.07
137 0.06
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.09
144 0.13
145 0.16
146 0.21
147 0.21
148 0.22
149 0.26
150 0.28
151 0.29
152 0.32
153 0.34
154 0.36
155 0.44
156 0.45
157 0.47
158 0.46
159 0.44
160 0.41
161 0.39
162 0.41
163 0.4
164 0.4
165 0.41
166 0.5
167 0.52
168 0.54
169 0.52
170 0.44
171 0.38
172 0.38
173 0.35
174 0.25
175 0.2
176 0.14
177 0.13
178 0.12
179 0.12
180 0.09
181 0.06
182 0.05
183 0.05
184 0.07
185 0.08
186 0.11
187 0.16
188 0.21
189 0.23
190 0.25
191 0.25
192 0.25
193 0.24
194 0.24
195 0.22
196 0.18
197 0.18
198 0.16
199 0.16
200 0.15
201 0.14
202 0.13
203 0.11
204 0.11
205 0.13
206 0.15
207 0.17
208 0.21
209 0.31
210 0.37
211 0.43
212 0.52
213 0.59
214 0.6
215 0.65
216 0.71
217 0.65
218 0.66
219 0.65
220 0.59
221 0.54
222 0.56
223 0.55
224 0.48
225 0.48
226 0.41
227 0.36
228 0.37
229 0.31
230 0.26
231 0.2
232 0.18
233 0.14
234 0.12
235 0.11
236 0.06
237 0.06
238 0.07
239 0.07
240 0.11
241 0.14
242 0.17
243 0.2
244 0.24
245 0.3
246 0.34
247 0.39
248 0.44
249 0.49
250 0.57
251 0.6
252 0.64
253 0.68
254 0.74
255 0.76
256 0.76
257 0.72
258 0.73
259 0.77
260 0.79
261 0.81
262 0.81
263 0.8
264 0.78
265 0.77
266 0.7
267 0.67
268 0.67
269 0.6
270 0.53
271 0.48
272 0.44
273 0.4
274 0.37
275 0.29
276 0.2
277 0.17
278 0.12
279 0.11
280 0.09
281 0.1
282 0.09
283 0.1
284 0.09
285 0.08
286 0.09
287 0.11
288 0.14
289 0.14
290 0.17
291 0.22
292 0.29
293 0.38
294 0.47
295 0.54
296 0.58
297 0.64
298 0.7
299 0.75
300 0.78
301 0.75
302 0.7
303 0.61
304 0.59
305 0.54
306 0.51
307 0.51
308 0.52
309 0.54
310 0.51
311 0.52
312 0.54
313 0.61
314 0.64
315 0.61
316 0.56
317 0.51