Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YMD1

Protein Details
Accession G2YMD1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-120ILPANTPNQRTKRPKDQKTKRPKDQNLPFVQSSHydrophilic
NLS Segment(s)
PositionSequence
100-108RPKDQKTKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MLGSVTENVAIKWRELEKQTSNINGPWSIINRPSTDQRASRQIPATGRQMRKLSPKKHPDLQVQSSDSYLLFPLGLFERRPFEPFLDILPANTPNQRTKRPKDQKTKRPKDQNLPFVQSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.36
4 0.35
5 0.4
6 0.43
7 0.43
8 0.42
9 0.39
10 0.38
11 0.31
12 0.28
13 0.24
14 0.23
15 0.21
16 0.22
17 0.23
18 0.22
19 0.25
20 0.29
21 0.31
22 0.34
23 0.35
24 0.35
25 0.41
26 0.42
27 0.44
28 0.41
29 0.4
30 0.38
31 0.38
32 0.43
33 0.42
34 0.41
35 0.41
36 0.4
37 0.4
38 0.48
39 0.53
40 0.51
41 0.53
42 0.6
43 0.6
44 0.65
45 0.68
46 0.65
47 0.64
48 0.61
49 0.55
50 0.48
51 0.43
52 0.37
53 0.31
54 0.23
55 0.15
56 0.12
57 0.07
58 0.05
59 0.04
60 0.05
61 0.07
62 0.08
63 0.09
64 0.1
65 0.13
66 0.15
67 0.17
68 0.17
69 0.17
70 0.18
71 0.18
72 0.18
73 0.19
74 0.18
75 0.17
76 0.18
77 0.18
78 0.17
79 0.2
80 0.21
81 0.25
82 0.31
83 0.41
84 0.48
85 0.55
86 0.65
87 0.73
88 0.8
89 0.83
90 0.88
91 0.89
92 0.92
93 0.94
94 0.93
95 0.94
96 0.93
97 0.93
98 0.92
99 0.92
100 0.89
101 0.85