Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YFZ7

Protein Details
Accession G2YFZ7    Localization Confidence High Confidence Score 22.9
NoLS Segment(s)
PositionSequenceProtein Nature
186-205ADLARLKKIREERKVREDQKBasic
210-229AEKNRRVEEQKKRDEAKREABasic
NLS Segment(s)
PositionSequence
8-25AGRGRGGKFKKFTRGGGK
77-93RRAAAKAKKEAAIKKKN
190-242RLKKIREERKVREDQKAAEEAEKNRRVEEQKKRDEAKREATMGPTAKGKKGKK
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
IPR039876  HAP28  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MAPGGPAAGRGRGGKFKKFTRGGGKHFSRDLRPLDANGNEIREKNADDSSSEEEEESEEESSEEEAEEKQEMTREQRRAAAKAKKEAAIKKKNQKVAQVGDLPTDSEEDSEDDDMPANPNHSKAARDQAKAPPKSVDEVAGEVAKMSVSKKPQELSRKEREAIEAQKKREAYQKLHLAGKTDEAQADLARLKKIREERKVREDQKAAEEAEKNRRVEEQKKRDEAKREATMGPTAKGKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.53
4 0.61
5 0.62
6 0.66
7 0.68
8 0.71
9 0.7
10 0.73
11 0.72
12 0.68
13 0.68
14 0.66
15 0.59
16 0.57
17 0.54
18 0.49
19 0.45
20 0.42
21 0.42
22 0.38
23 0.37
24 0.32
25 0.32
26 0.27
27 0.26
28 0.26
29 0.22
30 0.22
31 0.22
32 0.22
33 0.19
34 0.18
35 0.21
36 0.24
37 0.24
38 0.22
39 0.19
40 0.17
41 0.17
42 0.17
43 0.14
44 0.09
45 0.08
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.07
54 0.08
55 0.07
56 0.08
57 0.1
58 0.11
59 0.18
60 0.25
61 0.27
62 0.28
63 0.34
64 0.37
65 0.39
66 0.46
67 0.48
68 0.45
69 0.5
70 0.51
71 0.5
72 0.53
73 0.56
74 0.57
75 0.59
76 0.63
77 0.65
78 0.68
79 0.72
80 0.69
81 0.68
82 0.64
83 0.58
84 0.55
85 0.49
86 0.43
87 0.36
88 0.33
89 0.26
90 0.2
91 0.17
92 0.11
93 0.07
94 0.07
95 0.06
96 0.07
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.09
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.12
111 0.21
112 0.26
113 0.26
114 0.3
115 0.36
116 0.45
117 0.45
118 0.44
119 0.37
120 0.32
121 0.33
122 0.3
123 0.24
124 0.15
125 0.15
126 0.15
127 0.12
128 0.11
129 0.09
130 0.08
131 0.06
132 0.06
133 0.06
134 0.08
135 0.12
136 0.15
137 0.17
138 0.2
139 0.27
140 0.36
141 0.43
142 0.48
143 0.54
144 0.57
145 0.56
146 0.55
147 0.52
148 0.48
149 0.49
150 0.52
151 0.48
152 0.45
153 0.49
154 0.48
155 0.46
156 0.48
157 0.44
158 0.39
159 0.42
160 0.48
161 0.47
162 0.52
163 0.5
164 0.46
165 0.41
166 0.39
167 0.33
168 0.26
169 0.22
170 0.18
171 0.18
172 0.14
173 0.16
174 0.15
175 0.14
176 0.16
177 0.17
178 0.17
179 0.24
180 0.33
181 0.41
182 0.49
183 0.57
184 0.63
185 0.72
186 0.82
187 0.8
188 0.8
189 0.75
190 0.68
191 0.64
192 0.6
193 0.51
194 0.46
195 0.46
196 0.42
197 0.48
198 0.5
199 0.45
200 0.41
201 0.46
202 0.49
203 0.53
204 0.59
205 0.59
206 0.63
207 0.72
208 0.78
209 0.78
210 0.81
211 0.79
212 0.77
213 0.74
214 0.68
215 0.61
216 0.57
217 0.57
218 0.5
219 0.44
220 0.42
221 0.38
222 0.41