Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YD19

Protein Details
Accession G2YD19    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-67LSQKHQFRLERRYKRRTKLKWARPGWTKAHydrophilic
NLS Segment(s)
PositionSequence
46-62RLERRYKRRTKLKWARP
Subcellular Location(s) mito 11.5, mito_nucl 10.833, nucl 9, cyto_nucl 8.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MFRTLVRRAAQQTRFELPYDPNANPYKAKRLWPPDFSKLSQKHQFRLERRYKRRTKLKWARPGWTKAVKVAQLSSILCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.43
4 0.35
5 0.38
6 0.36
7 0.31
8 0.31
9 0.33
10 0.33
11 0.35
12 0.35
13 0.35
14 0.34
15 0.38
16 0.4
17 0.47
18 0.51
19 0.54
20 0.58
21 0.57
22 0.58
23 0.55
24 0.56
25 0.5
26 0.51
27 0.52
28 0.48
29 0.45
30 0.49
31 0.56
32 0.51
33 0.58
34 0.62
35 0.65
36 0.71
37 0.78
38 0.79
39 0.81
40 0.86
41 0.84
42 0.85
43 0.85
44 0.87
45 0.87
46 0.84
47 0.83
48 0.8
49 0.77
50 0.74
51 0.72
52 0.63
53 0.58
54 0.59
55 0.53
56 0.47
57 0.43
58 0.37
59 0.33