Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YUA9

Protein Details
Accession G2YUA9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-58RSPQHIQARRRCRREGRRDKHEEGNSBasic
NLS Segment(s)
PositionSequence
41-50RRRCRREGRR
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MGNCITRLETEMVAPPPISGNWKDFGPRKAISRSPQHIQARRRCRREGRRDKHEEGNSLLLARKETSSGIEGLTFDYAGRPVWLHISWRDPKLQIHDSDDSDVARVEDTEEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.16
4 0.16
5 0.19
6 0.16
7 0.18
8 0.18
9 0.19
10 0.24
11 0.28
12 0.3
13 0.31
14 0.31
15 0.34
16 0.38
17 0.43
18 0.44
19 0.48
20 0.51
21 0.49
22 0.56
23 0.6
24 0.61
25 0.64
26 0.67
27 0.69
28 0.73
29 0.75
30 0.73
31 0.75
32 0.78
33 0.81
34 0.83
35 0.81
36 0.83
37 0.85
38 0.82
39 0.8
40 0.72
41 0.63
42 0.53
43 0.46
44 0.35
45 0.27
46 0.24
47 0.15
48 0.13
49 0.11
50 0.1
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.09
70 0.1
71 0.13
72 0.15
73 0.23
74 0.28
75 0.3
76 0.33
77 0.32
78 0.35
79 0.4
80 0.43
81 0.39
82 0.4
83 0.41
84 0.4
85 0.41
86 0.38
87 0.31
88 0.25
89 0.23
90 0.17
91 0.13
92 0.11
93 0.1