Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y7S2

Protein Details
Accession G2Y7S2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-31IMLSTFTQPKPKPKPKPKPKPARNDAQSNHydrophilic
NLS Segment(s)
PositionSequence
12-25KPKPKPKPKPKPAR
Subcellular Location(s) mito 11, plas 10, extr 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MAIMLSTFTQPKPKPKPKPKPKPARNDAQSNIIWLVLKSMEASLIVALCFRPCLIDSFPLCSYSVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.84
4 0.86
5 0.94
6 0.95
7 0.95
8 0.94
9 0.94
10 0.89
11 0.89
12 0.83
13 0.79
14 0.7
15 0.65
16 0.55
17 0.45
18 0.38
19 0.28
20 0.22
21 0.14
22 0.12
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.05
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.11
41 0.13
42 0.21
43 0.22
44 0.27
45 0.29
46 0.29
47 0.29