Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YWH0

Protein Details
Accession G2YWH0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32NKFGGRKDKDKETSHKRDKSRDNKSAEKSNEBasic
NLS Segment(s)
PositionSequence
7-34RKDKDKETSHKRDKSRDNKSAEKSNEKK
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MNKFGGRKDKDKETSHKRDKSRDNKSAEKSNEKKSRSVSDIFTSLFVHIRNSKSEKEQDEDQEKISRIRSLLESDGHNDVKDDQILFCLNSIYANGNVEKAHQILLVFHNSLSGVIYPYDPKITMLGAQNSRGVTCWLDSFLASLFTVPTQFQELLNNFYEDPLKQNLIQLIRLWVNLMRSGILIEVNINKTRLRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.81
5 0.83
6 0.85
7 0.86
8 0.86
9 0.83
10 0.8
11 0.81
12 0.81
13 0.8
14 0.77
15 0.77
16 0.72
17 0.74
18 0.75
19 0.68
20 0.66
21 0.62
22 0.62
23 0.56
24 0.54
25 0.47
26 0.43
27 0.43
28 0.38
29 0.34
30 0.27
31 0.23
32 0.21
33 0.17
34 0.17
35 0.19
36 0.2
37 0.25
38 0.28
39 0.3
40 0.34
41 0.41
42 0.4
43 0.4
44 0.43
45 0.44
46 0.45
47 0.43
48 0.39
49 0.37
50 0.35
51 0.32
52 0.29
53 0.24
54 0.19
55 0.2
56 0.2
57 0.18
58 0.19
59 0.19
60 0.19
61 0.19
62 0.23
63 0.21
64 0.19
65 0.16
66 0.15
67 0.13
68 0.13
69 0.11
70 0.07
71 0.08
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.07
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.09
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.11
112 0.13
113 0.18
114 0.19
115 0.2
116 0.21
117 0.21
118 0.21
119 0.18
120 0.16
121 0.11
122 0.11
123 0.1
124 0.09
125 0.1
126 0.09
127 0.1
128 0.09
129 0.09
130 0.08
131 0.08
132 0.07
133 0.07
134 0.08
135 0.07
136 0.08
137 0.1
138 0.11
139 0.11
140 0.17
141 0.19
142 0.22
143 0.23
144 0.23
145 0.2
146 0.2
147 0.22
148 0.16
149 0.18
150 0.18
151 0.19
152 0.18
153 0.21
154 0.25
155 0.25
156 0.27
157 0.24
158 0.26
159 0.24
160 0.24
161 0.23
162 0.2
163 0.19
164 0.2
165 0.2
166 0.15
167 0.14
168 0.14
169 0.13
170 0.12
171 0.1
172 0.1
173 0.15
174 0.18
175 0.21
176 0.22
177 0.23