Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YPP9

Protein Details
Accession G2YPP9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ATLRRRAAPKAPRPRNKANMKLDDKHydrophilic
NLS Segment(s)
PositionSequence
20-34RRRAAPKAPRPRNKA
Subcellular Location(s) mito 18, mito_nucl 13, nucl 6
Family & Domain DBs
Amino Acid Sequences MLNHKLNLNNMSSFTMATLRRRAAPKAPRPRNKANMKLDDKIARCPGGTPAYQHRKEFLKHRPSVTEAEVKMARGADYKPLRTFKGLPAGTKKPARLNREEYCIIRDWRVANGVAPFRKPKFDTKWGWNHEDAWDVYYMTGKDPALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.24
5 0.28
6 0.28
7 0.33
8 0.37
9 0.4
10 0.44
11 0.51
12 0.57
13 0.63
14 0.71
15 0.75
16 0.8
17 0.85
18 0.86
19 0.86
20 0.85
21 0.83
22 0.83
23 0.78
24 0.73
25 0.68
26 0.65
27 0.57
28 0.52
29 0.46
30 0.36
31 0.31
32 0.29
33 0.28
34 0.25
35 0.24
36 0.22
37 0.29
38 0.38
39 0.41
40 0.4
41 0.39
42 0.39
43 0.42
44 0.46
45 0.46
46 0.47
47 0.47
48 0.49
49 0.48
50 0.47
51 0.47
52 0.42
53 0.38
54 0.28
55 0.28
56 0.26
57 0.24
58 0.21
59 0.18
60 0.15
61 0.11
62 0.11
63 0.15
64 0.18
65 0.2
66 0.23
67 0.25
68 0.26
69 0.28
70 0.29
71 0.24
72 0.31
73 0.3
74 0.29
75 0.34
76 0.37
77 0.4
78 0.41
79 0.41
80 0.4
81 0.46
82 0.49
83 0.5
84 0.54
85 0.51
86 0.55
87 0.55
88 0.48
89 0.44
90 0.42
91 0.37
92 0.3
93 0.29
94 0.24
95 0.22
96 0.24
97 0.2
98 0.18
99 0.21
100 0.26
101 0.25
102 0.27
103 0.32
104 0.31
105 0.37
106 0.38
107 0.42
108 0.45
109 0.52
110 0.57
111 0.6
112 0.68
113 0.69
114 0.71
115 0.64
116 0.57
117 0.5
118 0.47
119 0.38
120 0.29
121 0.24
122 0.19
123 0.17
124 0.19
125 0.17
126 0.14
127 0.17