Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y6W6

Protein Details
Accession G2Y6W6    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
8-30GLKVRRCCYRCLKKKGNLPHKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MGDISILGLKVRRCCYRCLKKKGNLPHKSLTSKITRSEEGSLAPYLIKAVVMEIDSLVLGAGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.52
3 0.61
4 0.68
5 0.72
6 0.76
7 0.75
8 0.82
9 0.86
10 0.86
11 0.82
12 0.78
13 0.74
14 0.7
15 0.65
16 0.58
17 0.51
18 0.46
19 0.4
20 0.39
21 0.36
22 0.31
23 0.3
24 0.31
25 0.27
26 0.22
27 0.22
28 0.18
29 0.15
30 0.13
31 0.11
32 0.09
33 0.08
34 0.07
35 0.04
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05