Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YSL5

Protein Details
Accession G2YSL5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-110LEECKFDSKRKDHPTRHYKSDKHKBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MSLSWRRYTGVLALIFRIHWVSRLDPSNSTIGTGSQPNVIENEKDKKRLYKCQEPGCESSRKFSLKDLKRHRNARHAENPDMFTCELEECKFDSKRKDHPTRHYKSDKHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.19
5 0.13
6 0.13
7 0.15
8 0.16
9 0.21
10 0.26
11 0.27
12 0.27
13 0.29
14 0.29
15 0.26
16 0.25
17 0.2
18 0.15
19 0.15
20 0.15
21 0.14
22 0.13
23 0.13
24 0.13
25 0.14
26 0.14
27 0.14
28 0.16
29 0.24
30 0.24
31 0.28
32 0.29
33 0.35
34 0.39
35 0.48
36 0.52
37 0.54
38 0.59
39 0.63
40 0.67
41 0.64
42 0.62
43 0.57
44 0.55
45 0.45
46 0.4
47 0.37
48 0.33
49 0.29
50 0.31
51 0.37
52 0.39
53 0.49
54 0.56
55 0.62
56 0.69
57 0.78
58 0.77
59 0.77
60 0.75
61 0.74
62 0.73
63 0.69
64 0.66
65 0.61
66 0.58
67 0.49
68 0.47
69 0.37
70 0.28
71 0.23
72 0.18
73 0.16
74 0.13
75 0.14
76 0.13
77 0.19
78 0.23
79 0.27
80 0.35
81 0.39
82 0.49
83 0.59
84 0.68
85 0.7
86 0.77
87 0.84
88 0.83
89 0.87
90 0.87