Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YK23

Protein Details
Accession G2YK23   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-66PTPKHPNTKPFHKSRDRPKNSPNFNITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTSSPPEATTTLASCSYRPAFAQNSEDNSRLSSYHILNFPTPKHPNTKPFHKSRDRPKNSPNFNIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.21
4 0.2
5 0.19
6 0.21
7 0.21
8 0.24
9 0.29
10 0.26
11 0.3
12 0.32
13 0.33
14 0.28
15 0.26
16 0.24
17 0.19
18 0.18
19 0.15
20 0.13
21 0.15
22 0.17
23 0.17
24 0.18
25 0.2
26 0.2
27 0.25
28 0.28
29 0.27
30 0.32
31 0.36
32 0.44
33 0.49
34 0.58
35 0.59
36 0.65
37 0.72
38 0.76
39 0.79
40 0.81
41 0.86
42 0.84
43 0.84
44 0.85
45 0.86
46 0.84