Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y6E2

Protein Details
Accession G2Y6E2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-103FVFGRFSKFRSRRGNRARLFHydrophilic
NLS Segment(s)
PositionSequence
95-97RRG
Subcellular Location(s) extr 10, cyto 8, cyto_mito 7.333, cyto_nucl 6.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLLLGFYRCRIYANVCADNLHSDINLYYNKRLPRGAFIFNTNYRKSPTLNEVGGPSQSITRSRQLLGLDSGDSWDHPRPSCTLFVFGRFSKFRSRRGNRARLFGPKRTYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.35
5 0.35
6 0.31
7 0.23
8 0.15
9 0.11
10 0.11
11 0.13
12 0.16
13 0.16
14 0.18
15 0.22
16 0.25
17 0.27
18 0.3
19 0.28
20 0.32
21 0.34
22 0.36
23 0.32
24 0.33
25 0.37
26 0.4
27 0.44
28 0.38
29 0.35
30 0.33
31 0.32
32 0.3
33 0.27
34 0.26
35 0.26
36 0.25
37 0.24
38 0.23
39 0.22
40 0.2
41 0.17
42 0.12
43 0.08
44 0.09
45 0.1
46 0.12
47 0.14
48 0.16
49 0.16
50 0.19
51 0.18
52 0.19
53 0.18
54 0.17
55 0.14
56 0.12
57 0.13
58 0.1
59 0.1
60 0.11
61 0.13
62 0.14
63 0.15
64 0.16
65 0.18
66 0.2
67 0.24
68 0.22
69 0.25
70 0.23
71 0.27
72 0.3
73 0.29
74 0.33
75 0.3
76 0.32
77 0.37
78 0.41
79 0.46
80 0.53
81 0.6
82 0.64
83 0.74
84 0.82
85 0.76
86 0.79
87 0.76
88 0.75
89 0.74
90 0.72