Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XPQ6

Protein Details
Accession G2XPQ6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNGFSCPRRKRTRSTKRMGLIKRCRCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MNGFSCPRRKRTRSTKRMGLIKRCRCHIKFTFLASRLKISGVLLKFPINILM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.82
4 0.85
5 0.83
6 0.82
7 0.81
8 0.8
9 0.74
10 0.7
11 0.71
12 0.62
13 0.63
14 0.56
15 0.53
16 0.47
17 0.49
18 0.51
19 0.46
20 0.49
21 0.42
22 0.4
23 0.33
24 0.29
25 0.25
26 0.18
27 0.22
28 0.19
29 0.2
30 0.2
31 0.2
32 0.2