Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y3Z2

Protein Details
Accession G2Y3Z2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-56EMKMGIKTKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEBasic
NLS Segment(s)
PositionSequence
13-55IKTKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MEMEKEMEMKMGIKTKKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKETPQHHHIITPSITPPSSSSCVVPPIFTSLSIKRLYSDFDIIYST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.55
4 0.62
5 0.69
6 0.71
7 0.79
8 0.83
9 0.86
10 0.87
11 0.85
12 0.87
13 0.86
14 0.86
15 0.83
16 0.83
17 0.81
18 0.81
19 0.81
20 0.81
21 0.81
22 0.81
23 0.81
24 0.81
25 0.81
26 0.81
27 0.81
28 0.81
29 0.81
30 0.81
31 0.81
32 0.81
33 0.81
34 0.81
35 0.81
36 0.81
37 0.81
38 0.79
39 0.74
40 0.73
41 0.7
42 0.69
43 0.65
44 0.63
45 0.58
46 0.57
47 0.53
48 0.46
49 0.41
50 0.36
51 0.31
52 0.25
53 0.22
54 0.17
55 0.17
56 0.16
57 0.16
58 0.17
59 0.19
60 0.19
61 0.19
62 0.18
63 0.24
64 0.23
65 0.22
66 0.18
67 0.2
68 0.2
69 0.2
70 0.23
71 0.2
72 0.25
73 0.27
74 0.26
75 0.22
76 0.23
77 0.26
78 0.26
79 0.27
80 0.23