Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y9X3

Protein Details
Accession G2Y9X3   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-115NIKQELLRREPRKEKKQAENQRSLRRCIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, plas 3
Family & Domain DBs
Amino Acid Sequences MTPAVLQLQLQHMGLQWGALSNKTLVAAYTLSIKHSRTEHSNIGQPLNLLPDYLWHFIFITITFPGLTHPHPCLSGIPYAYPYLSWTNIKQELLRREPRKEKKQAENQRSLRRCITMGGLESCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.1
5 0.1
6 0.1
7 0.11
8 0.1
9 0.11
10 0.11
11 0.11
12 0.08
13 0.09
14 0.09
15 0.08
16 0.12
17 0.12
18 0.14
19 0.16
20 0.17
21 0.18
22 0.2
23 0.23
24 0.24
25 0.3
26 0.32
27 0.33
28 0.38
29 0.36
30 0.36
31 0.32
32 0.27
33 0.22
34 0.19
35 0.16
36 0.1
37 0.08
38 0.1
39 0.13
40 0.14
41 0.14
42 0.12
43 0.12
44 0.12
45 0.13
46 0.1
47 0.08
48 0.06
49 0.07
50 0.06
51 0.06
52 0.07
53 0.08
54 0.09
55 0.1
56 0.11
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.15
63 0.13
64 0.12
65 0.13
66 0.13
67 0.13
68 0.11
69 0.12
70 0.12
71 0.14
72 0.15
73 0.15
74 0.21
75 0.24
76 0.25
77 0.25
78 0.3
79 0.36
80 0.42
81 0.51
82 0.5
83 0.56
84 0.66
85 0.74
86 0.77
87 0.79
88 0.8
89 0.81
90 0.87
91 0.89
92 0.88
93 0.89
94 0.88
95 0.88
96 0.84
97 0.78
98 0.71
99 0.63
100 0.54
101 0.45
102 0.41
103 0.35
104 0.35