Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y2Z9

Protein Details
Accession G2Y2Z9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-29GTVWTRSSRRRIPFNRHEKQHydrophilic
59-82KEVKREKSGSKQNNQHNKRKQASAHydrophilic
NLS Segment(s)
PositionSequence
55-71EKKGKEVKREKSGSKQN
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAIACHMKDGTVWTRSSRRRIPFNRHEKQISNENSGNMLVCLKKNKYVCEEDEKEKKGKEVKREKSGSKQNNQHNKRKQASATFPSPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.51
4 0.53
5 0.55
6 0.62
7 0.69
8 0.75
9 0.76
10 0.81
11 0.8
12 0.78
13 0.76
14 0.68
15 0.64
16 0.63
17 0.57
18 0.52
19 0.46
20 0.4
21 0.36
22 0.32
23 0.28
24 0.18
25 0.15
26 0.09
27 0.09
28 0.13
29 0.13
30 0.18
31 0.2
32 0.22
33 0.26
34 0.29
35 0.31
36 0.36
37 0.39
38 0.4
39 0.46
40 0.47
41 0.45
42 0.41
43 0.42
44 0.41
45 0.42
46 0.46
47 0.5
48 0.55
49 0.63
50 0.69
51 0.69
52 0.72
53 0.77
54 0.76
55 0.75
56 0.75
57 0.75
58 0.8
59 0.83
60 0.84
61 0.83
62 0.84
63 0.8
64 0.79
65 0.75
66 0.73
67 0.75
68 0.72