Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YNW4

Protein Details
Accession G2YNW4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-111TLKTKFSHKERSKKELAKPSEKTRTFHydrophilic
NLS Segment(s)
PositionSequence
94-103KERSKKELAK
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MPAGFPAYPASSFPNEKPPTLFHPSSPKSPKATPVSYSTSKSYTATSSSSSKDSTETTAKYTPANDTSSLYSTTSTISLLKHPFSTLKTKFSHKERSKKELAKPSEKTRTFDPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.35
4 0.36
5 0.35
6 0.38
7 0.43
8 0.42
9 0.35
10 0.43
11 0.45
12 0.52
13 0.54
14 0.52
15 0.49
16 0.5
17 0.54
18 0.51
19 0.51
20 0.44
21 0.43
22 0.45
23 0.43
24 0.44
25 0.38
26 0.33
27 0.31
28 0.29
29 0.25
30 0.19
31 0.18
32 0.16
33 0.17
34 0.17
35 0.18
36 0.18
37 0.18
38 0.17
39 0.16
40 0.16
41 0.16
42 0.17
43 0.16
44 0.18
45 0.19
46 0.19
47 0.19
48 0.19
49 0.17
50 0.17
51 0.18
52 0.15
53 0.15
54 0.16
55 0.17
56 0.18
57 0.16
58 0.13
59 0.12
60 0.12
61 0.1
62 0.09
63 0.09
64 0.09
65 0.13
66 0.15
67 0.16
68 0.16
69 0.17
70 0.19
71 0.21
72 0.3
73 0.28
74 0.33
75 0.35
76 0.41
77 0.47
78 0.52
79 0.61
80 0.6
81 0.68
82 0.69
83 0.74
84 0.78
85 0.79
86 0.81
87 0.8
88 0.79
89 0.79
90 0.78
91 0.8
92 0.8
93 0.76
94 0.7
95 0.68