Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R5K4

Protein Details
Accession C4R5K4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
123-143IQSLKNKMRNDDRRRFRQENLHydrophilic
NLS Segment(s)
PositionSequence
179-186KMGKRKGK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022592  Nucleolar_19  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0032040  C:small-subunit processome  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ppa:PAS_chr3_0785  -  
Pfam View protein in Pfam  
PF10863  NOP19  
Amino Acid Sequences MSNRKEIKYKNELQAKFQYAISQSNSKVASWVITPQKTTTSESADYANAFLNLPVIRQGSGLGSANNDDADEESTIGTIGDFVNGTKNLSTMTKKQKMKSQVDDKLARINNRHRVSKDDSKVIQSLKNKMRNDDRRRFRQENLEKQNSQRNQNDASDSSDEEQISRSVKKGSNLLIEAKMGKRKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.57
4 0.49
5 0.43
6 0.36
7 0.39
8 0.37
9 0.33
10 0.29
11 0.32
12 0.33
13 0.28
14 0.27
15 0.23
16 0.2
17 0.15
18 0.22
19 0.25
20 0.26
21 0.27
22 0.27
23 0.31
24 0.32
25 0.35
26 0.3
27 0.28
28 0.28
29 0.27
30 0.28
31 0.24
32 0.22
33 0.19
34 0.17
35 0.12
36 0.1
37 0.09
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.11
46 0.09
47 0.11
48 0.11
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.07
71 0.07
72 0.08
73 0.07
74 0.07
75 0.08
76 0.1
77 0.12
78 0.17
79 0.27
80 0.35
81 0.39
82 0.41
83 0.47
84 0.54
85 0.58
86 0.6
87 0.6
88 0.58
89 0.61
90 0.62
91 0.56
92 0.54
93 0.51
94 0.44
95 0.4
96 0.41
97 0.44
98 0.45
99 0.5
100 0.43
101 0.46
102 0.52
103 0.56
104 0.53
105 0.5
106 0.46
107 0.45
108 0.47
109 0.42
110 0.4
111 0.34
112 0.39
113 0.41
114 0.48
115 0.46
116 0.49
117 0.58
118 0.64
119 0.7
120 0.71
121 0.72
122 0.74
123 0.82
124 0.8
125 0.74
126 0.74
127 0.74
128 0.75
129 0.76
130 0.74
131 0.67
132 0.67
133 0.72
134 0.66
135 0.64
136 0.58
137 0.52
138 0.49
139 0.49
140 0.49
141 0.41
142 0.41
143 0.35
144 0.32
145 0.29
146 0.28
147 0.25
148 0.21
149 0.21
150 0.18
151 0.19
152 0.18
153 0.18
154 0.21
155 0.25
156 0.28
157 0.32
158 0.36
159 0.4
160 0.41
161 0.43
162 0.39
163 0.38
164 0.38
165 0.38
166 0.4