Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YVH7

Protein Details
Accession G2YVH7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
122-148LTAEIRHKFERKRRRPQVRRVTRSPISHydrophilic
NLS Segment(s)
PositionSequence
127-141RHKFERKRRRPQVRR
Subcellular Location(s) mito 14, cyto_mito 10, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MIFGFLRAAIRIELRFASLRYYPRRKLDARVFDFEECGDGIDRWNIGNERLRKQIVGWSEKNRVRISFPPIKRDGDGNEGLPIQELQATASVIIIAGSEATVSVLSNITKYLVNKPLKPALLTAEIRHKFERKRRRPQVRRVTRSPISTQSPRKDLDSVIPPKLHLELARYELENLRSPEPRGFTVKERKPLDWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.18
4 0.21
5 0.23
6 0.3
7 0.38
8 0.46
9 0.5
10 0.55
11 0.63
12 0.62
13 0.67
14 0.69
15 0.7
16 0.67
17 0.67
18 0.63
19 0.55
20 0.53
21 0.43
22 0.34
23 0.23
24 0.18
25 0.13
26 0.09
27 0.1
28 0.11
29 0.11
30 0.1
31 0.13
32 0.13
33 0.15
34 0.23
35 0.27
36 0.3
37 0.35
38 0.36
39 0.33
40 0.33
41 0.34
42 0.34
43 0.36
44 0.37
45 0.37
46 0.45
47 0.48
48 0.52
49 0.49
50 0.44
51 0.4
52 0.4
53 0.42
54 0.43
55 0.43
56 0.45
57 0.46
58 0.47
59 0.43
60 0.41
61 0.35
62 0.31
63 0.29
64 0.23
65 0.21
66 0.19
67 0.18
68 0.15
69 0.13
70 0.07
71 0.07
72 0.06
73 0.05
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.03
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.07
97 0.09
98 0.13
99 0.21
100 0.25
101 0.26
102 0.3
103 0.34
104 0.33
105 0.32
106 0.28
107 0.23
108 0.26
109 0.26
110 0.24
111 0.29
112 0.3
113 0.32
114 0.34
115 0.36
116 0.36
117 0.45
118 0.55
119 0.56
120 0.65
121 0.74
122 0.83
123 0.87
124 0.91
125 0.93
126 0.93
127 0.91
128 0.86
129 0.84
130 0.78
131 0.73
132 0.66
133 0.61
134 0.57
135 0.57
136 0.59
137 0.56
138 0.56
139 0.53
140 0.51
141 0.46
142 0.4
143 0.38
144 0.4
145 0.38
146 0.39
147 0.38
148 0.35
149 0.35
150 0.35
151 0.3
152 0.22
153 0.2
154 0.19
155 0.22
156 0.25
157 0.24
158 0.24
159 0.26
160 0.28
161 0.31
162 0.31
163 0.31
164 0.32
165 0.34
166 0.37
167 0.37
168 0.37
169 0.37
170 0.38
171 0.42
172 0.5
173 0.56
174 0.6
175 0.61