Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UM46

Protein Details
Accession Q0UM46   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-29GAGTNPIHNKKPKKKAQDLDEDDIHydrophilic
NLS Segment(s)
PositionSequence
16-19KPKK
74-95KVGKGKGPLNTGSQGIKKSGKK
Subcellular Location(s) mito 16, nucl 8, cyto 1, pero 1, cysk 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG pno:SNOG_07168  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MPSGQGAGTNPIHNKKPKKKAQDLDEDDIAHKAKLAAGWSHPVYYISLDTSTTSSHNMLRHEYYKKARDELAGKVGKGKGPLNTGSQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.67
4 0.72
5 0.78
6 0.83
7 0.85
8 0.85
9 0.85
10 0.82
11 0.77
12 0.7
13 0.6
14 0.5
15 0.43
16 0.35
17 0.23
18 0.16
19 0.11
20 0.09
21 0.09
22 0.1
23 0.1
24 0.1
25 0.15
26 0.15
27 0.15
28 0.14
29 0.14
30 0.12
31 0.12
32 0.11
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.09
42 0.12
43 0.14
44 0.15
45 0.18
46 0.2
47 0.25
48 0.27
49 0.32
50 0.36
51 0.41
52 0.42
53 0.41
54 0.4
55 0.4
56 0.4
57 0.38
58 0.4
59 0.35
60 0.33
61 0.36
62 0.36
63 0.32
64 0.33
65 0.31
66 0.26
67 0.28
68 0.31
69 0.3
70 0.31
71 0.31
72 0.32
73 0.34
74 0.31
75 0.32