Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y216

Protein Details
Accession G2Y216    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-81SQLGPKLRPKLRPKPKPNAERSVHHydrophilic
NLS Segment(s)
PositionSequence
62-75PKLRPKLRPKPKPN
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSESKLNILFRIPWANQSLHRIHRTGRRRGIFKECSNGGVEEVEEGKEVHGVRRETESQLGPKLRPKLRPKPKPNAERSVHDYRGKMPAAEATSVGDEDLIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.32
4 0.36
5 0.39
6 0.39
7 0.42
8 0.39
9 0.4
10 0.48
11 0.53
12 0.56
13 0.59
14 0.59
15 0.61
16 0.64
17 0.69
18 0.67
19 0.62
20 0.59
21 0.5
22 0.45
23 0.42
24 0.37
25 0.27
26 0.19
27 0.16
28 0.1
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.08
35 0.08
36 0.09
37 0.14
38 0.14
39 0.14
40 0.18
41 0.2
42 0.19
43 0.22
44 0.22
45 0.19
46 0.23
47 0.25
48 0.22
49 0.26
50 0.33
51 0.35
52 0.42
53 0.49
54 0.55
55 0.65
56 0.74
57 0.78
58 0.81
59 0.86
60 0.88
61 0.86
62 0.85
63 0.79
64 0.74
65 0.73
66 0.71
67 0.66
68 0.6
69 0.54
70 0.47
71 0.49
72 0.44
73 0.36
74 0.28
75 0.28
76 0.26
77 0.26
78 0.23
79 0.18
80 0.18
81 0.18
82 0.17
83 0.11