Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y1R7

Protein Details
Accession G2Y1R7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-47LAVRRKKKVHIGPLHKKNKRBasic
NLS Segment(s)
PositionSequence
31-48RRKKKVHIGPLHKKNKRR
Subcellular Location(s) mito 19.5, mito_nucl 12, nucl 3.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVWWMCCHGKVQIPRGSTNQLYLGATSLAVRRKKKVHIGPLHKKNKRRTANSFGPSGQFRSVMLSARTLEGVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.48
4 0.41
5 0.37
6 0.3
7 0.26
8 0.24
9 0.2
10 0.17
11 0.12
12 0.11
13 0.1
14 0.11
15 0.15
16 0.21
17 0.23
18 0.27
19 0.31
20 0.36
21 0.44
22 0.48
23 0.52
24 0.56
25 0.65
26 0.71
27 0.77
28 0.83
29 0.79
30 0.8
31 0.79
32 0.8
33 0.79
34 0.77
35 0.74
36 0.73
37 0.78
38 0.73
39 0.67
40 0.58
41 0.52
42 0.46
43 0.41
44 0.32
45 0.23
46 0.2
47 0.22
48 0.22
49 0.22
50 0.21
51 0.21
52 0.21
53 0.22