Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y0X9

Protein Details
Accession G2Y0X9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90QSNPISNDVKKKKEKKTTRTVREVGKHydrophilic
NLS Segment(s)
PositionSequence
74-83KKKKEKKTTR
Subcellular Location(s) nucl 9, pero 8, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MYGIPIGTALCVLRLASYEKEYLIRWRIYILNAILSAILIPTPIPIPSTKPNPIQSNPIQSNPIQSNPISNDVKKKKEKKTTRTVREVGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.13
4 0.15
5 0.15
6 0.16
7 0.18
8 0.19
9 0.23
10 0.25
11 0.23
12 0.21
13 0.23
14 0.24
15 0.23
16 0.26
17 0.2
18 0.16
19 0.15
20 0.15
21 0.12
22 0.11
23 0.09
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.09
34 0.14
35 0.19
36 0.23
37 0.28
38 0.33
39 0.37
40 0.39
41 0.42
42 0.41
43 0.45
44 0.43
45 0.41
46 0.37
47 0.32
48 0.37
49 0.32
50 0.31
51 0.24
52 0.21
53 0.23
54 0.24
55 0.31
56 0.29
57 0.29
58 0.37
59 0.43
60 0.52
61 0.58
62 0.65
63 0.68
64 0.76
65 0.84
66 0.84
67 0.87
68 0.89
69 0.89
70 0.9