Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XZX4

Protein Details
Accession G2XZX4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-59GMSSSKLRCFNKRRRKPVRSHRQDVQSSRHydrophilic
NLS Segment(s)
PositionSequence
43-47RRRKP
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSQDAVKATKPIVGGPVSMRNGIRTESSTTGMSSSKLRCFNKRRRKPVRSHRQDVQSSRICNEDIFRPDFEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.25
4 0.23
5 0.25
6 0.24
7 0.22
8 0.23
9 0.22
10 0.21
11 0.16
12 0.18
13 0.18
14 0.2
15 0.19
16 0.18
17 0.18
18 0.17
19 0.15
20 0.15
21 0.15
22 0.18
23 0.25
24 0.27
25 0.35
26 0.44
27 0.54
28 0.62
29 0.7
30 0.76
31 0.8
32 0.87
33 0.89
34 0.91
35 0.92
36 0.9
37 0.87
38 0.84
39 0.82
40 0.81
41 0.74
42 0.72
43 0.67
44 0.59
45 0.53
46 0.48
47 0.39
48 0.32
49 0.31
50 0.29
51 0.28
52 0.29