Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U4R0

Protein Details
Accession Q0U4R0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-36EQMKKAFKGLFKKKSKKEEPKPTATTEHydrophilic
NLS Segment(s)
PositionSequence
14-29KAFKGLFKKKSKKEEP
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
KEGG pno:SNOG_13254  -  
Amino Acid Sequences MPGVPPDAMEQMKKAFKGLFKKKSKKEEPKPTATTETPSQATPAAEPAKTETAPAPAPATAPAPAPAKTEATPAESSSAPAPAPAEPVPAPAPAPAQGEANKDEVAALAEVKKATQTPEPAGAVAPAPPTAASAPTTSTEAPAEAATKPVEAPTTTTAEAPEPSEPAALDMPAIPASQPAAGMSATSGPLNDDPFSPEAKEEKPVAPAPTPAAPAAVPEATPAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.32
4 0.42
5 0.51
6 0.55
7 0.61
8 0.72
9 0.79
10 0.86
11 0.9
12 0.91
13 0.91
14 0.92
15 0.9
16 0.89
17 0.85
18 0.79
19 0.75
20 0.65
21 0.59
22 0.51
23 0.47
24 0.38
25 0.34
26 0.3
27 0.25
28 0.24
29 0.19
30 0.22
31 0.2
32 0.18
33 0.19
34 0.22
35 0.23
36 0.23
37 0.23
38 0.18
39 0.19
40 0.19
41 0.2
42 0.17
43 0.13
44 0.14
45 0.14
46 0.14
47 0.11
48 0.11
49 0.14
50 0.14
51 0.15
52 0.16
53 0.17
54 0.18
55 0.18
56 0.2
57 0.17
58 0.2
59 0.2
60 0.18
61 0.19
62 0.16
63 0.17
64 0.15
65 0.15
66 0.1
67 0.1
68 0.1
69 0.08
70 0.11
71 0.1
72 0.12
73 0.11
74 0.13
75 0.14
76 0.13
77 0.13
78 0.11
79 0.11
80 0.1
81 0.12
82 0.11
83 0.11
84 0.13
85 0.15
86 0.16
87 0.17
88 0.15
89 0.13
90 0.12
91 0.1
92 0.09
93 0.07
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.08
102 0.1
103 0.12
104 0.13
105 0.16
106 0.16
107 0.16
108 0.15
109 0.14
110 0.11
111 0.1
112 0.08
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.08
122 0.09
123 0.11
124 0.1
125 0.11
126 0.1
127 0.09
128 0.1
129 0.09
130 0.09
131 0.07
132 0.09
133 0.08
134 0.08
135 0.08
136 0.08
137 0.09
138 0.08
139 0.11
140 0.12
141 0.15
142 0.15
143 0.16
144 0.16
145 0.16
146 0.16
147 0.15
148 0.13
149 0.11
150 0.1
151 0.11
152 0.1
153 0.1
154 0.1
155 0.08
156 0.08
157 0.07
158 0.08
159 0.08
160 0.08
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.06
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.09
176 0.1
177 0.13
178 0.13
179 0.12
180 0.15
181 0.16
182 0.18
183 0.17
184 0.18
185 0.2
186 0.2
187 0.25
188 0.25
189 0.25
190 0.29
191 0.32
192 0.33
193 0.32
194 0.32
195 0.31
196 0.31
197 0.31
198 0.26
199 0.24
200 0.19
201 0.19
202 0.21
203 0.17
204 0.14
205 0.13