Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0U273

Protein Details
Accession Q0U273    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHKKADKAGBasic
NLS Segment(s)
PositionSequence
8-24RIQREHKKADKAGTRAP
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG pno:SNOG_14239  -  
Amino Acid Sequences MPISKKDRIQREHKKADKAGTRAPVKANGLPVKAPKPTSICQNCRREIVNTNKVQLEAHAQSHDQTLWPKEKCWPNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.79
4 0.75
5 0.69
6 0.65
7 0.62
8 0.58
9 0.52
10 0.5
11 0.45
12 0.41
13 0.37
14 0.38
15 0.32
16 0.3
17 0.29
18 0.3
19 0.28
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.55
30 0.54
31 0.52
32 0.52
33 0.45
34 0.45
35 0.48
36 0.48
37 0.43
38 0.44
39 0.42
40 0.41
41 0.37
42 0.3
43 0.27
44 0.2
45 0.2
46 0.19
47 0.19
48 0.19
49 0.21
50 0.21
51 0.16
52 0.18
53 0.22
54 0.29
55 0.3
56 0.31
57 0.38
58 0.46