Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YT95

Protein Details
Accession G2YT95    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-79QAYRDCKKQWIEQRKEAKRKAGWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MASDKPADNPWDKETSQKFESKRPGEYFDPCQEAASRSLKCLARNGGDRDMCTDYFQAYRDCKKQWIEQRKEAKRKAGWFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.44
4 0.46
5 0.45
6 0.47
7 0.57
8 0.52
9 0.53
10 0.5
11 0.51
12 0.49
13 0.51
14 0.49
15 0.43
16 0.43
17 0.35
18 0.33
19 0.28
20 0.26
21 0.25
22 0.24
23 0.2
24 0.17
25 0.23
26 0.24
27 0.24
28 0.26
29 0.25
30 0.24
31 0.29
32 0.32
33 0.33
34 0.32
35 0.31
36 0.31
37 0.31
38 0.28
39 0.24
40 0.2
41 0.15
42 0.16
43 0.17
44 0.18
45 0.19
46 0.25
47 0.29
48 0.31
49 0.35
50 0.39
51 0.46
52 0.53
53 0.59
54 0.61
55 0.67
56 0.75
57 0.8
58 0.86
59 0.83
60 0.82
61 0.78
62 0.78