Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YAE9

Protein Details
Accession G2YAE9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-71DKKNGIAKRNTRNTRGKRRKESKKGDFDSMBasic
NLS Segment(s)
PositionSequence
29-65KVMVRKRLRPDSNDKKNGIAKRNTRNTRGKRRKESKK
Subcellular Location(s) nucl 22.5, mito_nucl 13.333, mito 3, cyto_mito 2.833
Family & Domain DBs
Amino Acid Sequences MITITTMQEPFFDKEKNSWVMRRTTEIRKVMVRKRLRPDSNDKKNGIAKRNTRNTRGKRRKESKKGDFDSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.34
4 0.34
5 0.35
6 0.36
7 0.4
8 0.4
9 0.43
10 0.43
11 0.44
12 0.49
13 0.47
14 0.46
15 0.46
16 0.51
17 0.51
18 0.55
19 0.55
20 0.54
21 0.59
22 0.66
23 0.63
24 0.62
25 0.66
26 0.68
27 0.71
28 0.71
29 0.63
30 0.59
31 0.62
32 0.63
33 0.6
34 0.57
35 0.55
36 0.59
37 0.68
38 0.69
39 0.71
40 0.76
41 0.78
42 0.81
43 0.84
44 0.84
45 0.85
46 0.9
47 0.93
48 0.94
49 0.94
50 0.93
51 0.94