Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UK22

Protein Details
Accession Q0UK22   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-34QPTSPKPTKRASPAYKPKEDAHydrophilic
153-178GIDLYKRKKKEEERKKSEREIRREEIBasic
NLS Segment(s)
PositionSequence
158-197KRKKKEEERKKSEREIRREEISRARDAERNERLAERREKE
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
KEGG pno:SNOG_07892  -  
Amino Acid Sequences MLKTAQETAQSFQQPTSPKPTKRASPAYKPKEDASDQSDDDFGPAPPTAGEQRKGHGPTVPGFDDLAYRNEMRDEDRARDRSNYVDDIRHERKTDRKAQKEQLDELVPRADPGSRERQLEKKREVTSTLQSFRDAKESGDVEVPESDLMGDDGIDLYKRKKKEEERKKSEREIRREEISRARDAERNERLAERREKEGKTMEFLRQIAKERFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.4
4 0.42
5 0.43
6 0.5
7 0.57
8 0.61
9 0.66
10 0.73
11 0.71
12 0.73
13 0.8
14 0.81
15 0.81
16 0.76
17 0.69
18 0.65
19 0.59
20 0.53
21 0.47
22 0.44
23 0.37
24 0.35
25 0.33
26 0.25
27 0.24
28 0.2
29 0.14
30 0.11
31 0.1
32 0.09
33 0.09
34 0.11
35 0.17
36 0.2
37 0.25
38 0.24
39 0.26
40 0.33
41 0.35
42 0.34
43 0.31
44 0.29
45 0.27
46 0.31
47 0.3
48 0.24
49 0.22
50 0.21
51 0.2
52 0.19
53 0.17
54 0.14
55 0.13
56 0.13
57 0.14
58 0.14
59 0.14
60 0.19
61 0.2
62 0.23
63 0.3
64 0.34
65 0.34
66 0.36
67 0.35
68 0.31
69 0.32
70 0.31
71 0.25
72 0.25
73 0.26
74 0.32
75 0.35
76 0.34
77 0.32
78 0.3
79 0.36
80 0.4
81 0.49
82 0.5
83 0.55
84 0.6
85 0.67
86 0.71
87 0.67
88 0.61
89 0.54
90 0.46
91 0.38
92 0.31
93 0.24
94 0.17
95 0.14
96 0.12
97 0.1
98 0.08
99 0.12
100 0.19
101 0.2
102 0.23
103 0.25
104 0.34
105 0.41
106 0.48
107 0.49
108 0.48
109 0.48
110 0.48
111 0.49
112 0.44
113 0.44
114 0.43
115 0.42
116 0.35
117 0.34
118 0.34
119 0.31
120 0.31
121 0.24
122 0.17
123 0.18
124 0.18
125 0.18
126 0.19
127 0.18
128 0.15
129 0.15
130 0.15
131 0.1
132 0.09
133 0.08
134 0.05
135 0.05
136 0.04
137 0.04
138 0.03
139 0.04
140 0.04
141 0.05
142 0.06
143 0.11
144 0.17
145 0.19
146 0.23
147 0.32
148 0.43
149 0.54
150 0.64
151 0.71
152 0.75
153 0.83
154 0.87
155 0.88
156 0.86
157 0.85
158 0.83
159 0.8
160 0.76
161 0.74
162 0.7
163 0.65
164 0.65
165 0.59
166 0.55
167 0.49
168 0.46
169 0.43
170 0.44
171 0.49
172 0.46
173 0.46
174 0.43
175 0.45
176 0.46
177 0.51
178 0.56
179 0.49
180 0.52
181 0.56
182 0.55
183 0.55
184 0.59
185 0.54
186 0.51
187 0.52
188 0.48
189 0.47
190 0.47
191 0.46
192 0.42
193 0.47