Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y3E8

Protein Details
Accession G2Y3E8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-36SSGVKFSRTKKKYNSRELNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MPLPTELSTSGWCRVVSSGVKFSRTKKKYNSRELNAYLLHGKDNSQELLGNPNHNPSQEEKAVPCCLYDPQEFEFTISTKETNPKGPSVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.24
4 0.25
5 0.31
6 0.3
7 0.35
8 0.37
9 0.43
10 0.49
11 0.49
12 0.52
13 0.54
14 0.63
15 0.68
16 0.77
17 0.8
18 0.75
19 0.79
20 0.73
21 0.67
22 0.56
23 0.47
24 0.38
25 0.28
26 0.23
27 0.15
28 0.13
29 0.11
30 0.12
31 0.11
32 0.09
33 0.09
34 0.09
35 0.15
36 0.15
37 0.16
38 0.14
39 0.17
40 0.18
41 0.18
42 0.19
43 0.17
44 0.22
45 0.22
46 0.24
47 0.22
48 0.25
49 0.28
50 0.26
51 0.23
52 0.18
53 0.18
54 0.21
55 0.21
56 0.21
57 0.21
58 0.24
59 0.24
60 0.23
61 0.23
62 0.19
63 0.2
64 0.17
65 0.16
66 0.16
67 0.23
68 0.25
69 0.32
70 0.34