Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XQ22

Protein Details
Accession G2XQ22    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-146LWRLRRPLDPPKPKSKKGKKGPRPRQDCDGVBasic
NLS Segment(s)
PositionSequence
120-140RRPLDPPKPKSKKGKKGPRPR
Subcellular Location(s) cyto 11, nucl 5, mito 4, pero 4, extr 3
Family & Domain DBs
Amino Acid Sequences MGLRPYINLAVEPAPAAPVLAPGLPAGPRPAIWPKTSNKDTPKNYVQGEYDLLPGGVDFVGSRAWLLNSHPGAREKGTPWFLASLLGTISKKGFNDLFINKGDAGIVEDDVEGEGLWRLRRPLDPPKPKSKKGKKGPRPRQDCDGVNPPGDSDNQPAAKKRKGVRFPPIFMVLFGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.07
5 0.07
6 0.08
7 0.07
8 0.07
9 0.07
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.11
16 0.15
17 0.23
18 0.25
19 0.28
20 0.33
21 0.37
22 0.46
23 0.5
24 0.54
25 0.54
26 0.6
27 0.62
28 0.64
29 0.64
30 0.6
31 0.57
32 0.53
33 0.46
34 0.38
35 0.35
36 0.28
37 0.23
38 0.17
39 0.15
40 0.11
41 0.09
42 0.08
43 0.06
44 0.04
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.04
51 0.05
52 0.06
53 0.07
54 0.13
55 0.14
56 0.16
57 0.18
58 0.2
59 0.21
60 0.22
61 0.23
62 0.18
63 0.22
64 0.23
65 0.21
66 0.2
67 0.19
68 0.17
69 0.16
70 0.14
71 0.08
72 0.07
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.1
80 0.1
81 0.1
82 0.15
83 0.16
84 0.18
85 0.17
86 0.19
87 0.16
88 0.16
89 0.14
90 0.09
91 0.09
92 0.07
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.04
100 0.03
101 0.04
102 0.05
103 0.06
104 0.07
105 0.08
106 0.1
107 0.13
108 0.18
109 0.29
110 0.39
111 0.49
112 0.55
113 0.66
114 0.72
115 0.78
116 0.83
117 0.83
118 0.83
119 0.84
120 0.88
121 0.87
122 0.91
123 0.94
124 0.93
125 0.91
126 0.86
127 0.83
128 0.79
129 0.72
130 0.67
131 0.65
132 0.57
133 0.49
134 0.44
135 0.37
136 0.31
137 0.29
138 0.25
139 0.2
140 0.25
141 0.28
142 0.3
143 0.38
144 0.43
145 0.47
146 0.52
147 0.56
148 0.6
149 0.64
150 0.71
151 0.74
152 0.76
153 0.75
154 0.74
155 0.71
156 0.61