Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XRP5

Protein Details
Accession G2XRP5   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIKSGKRKLKKSLRGKDVIEBasic
NLS Segment(s)
PositionSequence
4-16SGKRKLKKSLRGK
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MIKSGKRKLKKSLRGKDVIERKAANEIDSISPLPKNTFSKNPKSSIHFPKSIRYPELVCVSILRLPYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.76
5 0.69
6 0.63
7 0.53
8 0.45
9 0.45
10 0.42
11 0.32
12 0.24
13 0.22
14 0.17
15 0.18
16 0.17
17 0.11
18 0.11
19 0.11
20 0.11
21 0.13
22 0.15
23 0.17
24 0.26
25 0.32
26 0.41
27 0.45
28 0.49
29 0.49
30 0.53
31 0.59
32 0.6
33 0.6
34 0.57
35 0.54
36 0.57
37 0.61
38 0.59
39 0.52
40 0.45
41 0.41
42 0.4
43 0.43
44 0.36
45 0.29
46 0.25
47 0.25
48 0.24