Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YXF8

Protein Details
Accession G2YXF8   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-43TSVYICSKLKRWQRNHKKIVSHRRCGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MCVEQEVRCTGCNESSTSVYICSKLKRWQRNHKKIVSHRRCGEFSISRPRKQTSLAHMDCPIRSEQEQEEEQIEHQHDEAFMYDYASQWSSPIQTYPIYAMPYPHYPSWCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.24
4 0.23
5 0.23
6 0.2
7 0.21
8 0.22
9 0.22
10 0.25
11 0.32
12 0.41
13 0.48
14 0.57
15 0.66
16 0.75
17 0.82
18 0.87
19 0.86
20 0.86
21 0.86
22 0.88
23 0.86
24 0.83
25 0.78
26 0.74
27 0.68
28 0.6
29 0.56
30 0.49
31 0.44
32 0.47
33 0.46
34 0.44
35 0.46
36 0.45
37 0.4
38 0.4
39 0.39
40 0.35
41 0.4
42 0.38
43 0.36
44 0.38
45 0.37
46 0.33
47 0.3
48 0.24
49 0.16
50 0.15
51 0.16
52 0.14
53 0.17
54 0.17
55 0.17
56 0.18
57 0.16
58 0.16
59 0.17
60 0.17
61 0.12
62 0.12
63 0.12
64 0.1
65 0.1
66 0.11
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.12
74 0.11
75 0.09
76 0.1
77 0.1
78 0.11
79 0.12
80 0.12
81 0.12
82 0.14
83 0.16
84 0.18
85 0.19
86 0.19
87 0.2
88 0.23
89 0.28
90 0.31
91 0.32