Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YTU9

Protein Details
Accession G2YTU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73KEPSLVRLKFRRKRDEVGRREARYBasic
NLS Segment(s)
PositionSequence
56-69RLKFRRKRDEVGRR
Subcellular Location(s) mito 21, cyto_mito 12.666, mito_nucl 12.166, cyto_nucl 3.166, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042776  MRPL44  
IPR019716  Ribosomal_L53_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10780  MRP_L53  
Amino Acid Sequences MITRFITEVSTVFNPFSPKAKTARLFLSVLPPNARQTMKIDTKILPRASKEPSLVRLKFRRKRDEVGRREARY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.22
5 0.23
6 0.26
7 0.34
8 0.35
9 0.35
10 0.37
11 0.36
12 0.34
13 0.32
14 0.36
15 0.31
16 0.3
17 0.28
18 0.26
19 0.24
20 0.26
21 0.26
22 0.18
23 0.18
24 0.24
25 0.26
26 0.27
27 0.28
28 0.27
29 0.31
30 0.37
31 0.37
32 0.32
33 0.3
34 0.33
35 0.35
36 0.36
37 0.34
38 0.32
39 0.36
40 0.43
41 0.42
42 0.47
43 0.52
44 0.6
45 0.64
46 0.7
47 0.74
48 0.71
49 0.78
50 0.81
51 0.82
52 0.8
53 0.83