Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YJT9

Protein Details
Accession G2YJT9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
558-578STHLPCKRPDHLQTHKKTFVKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 3, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046342  CBS_dom_sf  
IPR014743  Cl-channel_core  
IPR001807  Cl-channel_volt-gated  
Gene Ontology GO:0016020  C:membrane  
GO:0005247  F:voltage-gated chloride channel activity  
Pfam View protein in Pfam  
PF00654  Voltage_CLC  
CDD cd03684  ClC_3_like  
Amino Acid Sequences MIYYSAAGSGVAEVRVILSGFVLHGFLGFKTLLVKTLALILSVASGLSLGKEGPFVHIATCVGNIACRLFSKYDDNDGKRREVLSAAAAAGVAVAFGAPIGGVLFSLEEVAYFFPAKTLFRTFFCCITAALTLKFLNPYGTNKIVMFEVRYLTDWTFFELAAFIMVGVLGGITGATFIKASRSWAQSFRKIEIIKKWPLFEVMLVALLTGLVSYWNPYTKIPVAKLLFNLASPCDTDKSDSMGLCPNSIDEIFPIIGQLTIAFFIKGLLTIITFGIKVPAGIYVPSMVVGGLLGRIVGHLVQWLVLTFPQASIFESCAAHESGTSCITPGVYALIAAGSTMCGVTRLSVTLAVILFELTGSLDYVLPFSLAVLVSKWTADFMEPLSIYDLLTNLNAYPFLNNKHKPIFTSDLADIVPRVRRERVIDISVSPMIPASSLRQKLELLHQAGEVDGGLPIIRDDVLVGLIPAPDLEFALDNLDNEPGTLCLMATISNYDDSEEEERVDPTDFTPYIDPAPVALDIRSPMDLVYECFVKLGLRYVCVLKDGRYAGLVIYPTSTHLPCKRPDHLQTHKKTFVKYMRELEERDGHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.07
5 0.06
6 0.06
7 0.07
8 0.07
9 0.07
10 0.06
11 0.07
12 0.08
13 0.08
14 0.1
15 0.09
16 0.09
17 0.12
18 0.13
19 0.14
20 0.15
21 0.15
22 0.13
23 0.19
24 0.19
25 0.15
26 0.15
27 0.12
28 0.11
29 0.11
30 0.1
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.08
39 0.08
40 0.12
41 0.14
42 0.14
43 0.14
44 0.15
45 0.15
46 0.15
47 0.15
48 0.13
49 0.11
50 0.11
51 0.12
52 0.11
53 0.12
54 0.13
55 0.16
56 0.16
57 0.19
58 0.26
59 0.28
60 0.36
61 0.44
62 0.48
63 0.53
64 0.55
65 0.56
66 0.51
67 0.49
68 0.41
69 0.33
70 0.29
71 0.24
72 0.22
73 0.18
74 0.15
75 0.14
76 0.12
77 0.1
78 0.08
79 0.05
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.07
99 0.07
100 0.07
101 0.08
102 0.1
103 0.11
104 0.14
105 0.18
106 0.2
107 0.21
108 0.28
109 0.3
110 0.3
111 0.3
112 0.28
113 0.23
114 0.22
115 0.23
116 0.19
117 0.17
118 0.17
119 0.16
120 0.16
121 0.17
122 0.15
123 0.15
124 0.15
125 0.19
126 0.22
127 0.24
128 0.25
129 0.24
130 0.24
131 0.23
132 0.21
133 0.19
134 0.15
135 0.14
136 0.13
137 0.15
138 0.16
139 0.15
140 0.17
141 0.15
142 0.17
143 0.16
144 0.15
145 0.13
146 0.11
147 0.11
148 0.08
149 0.08
150 0.04
151 0.04
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.06
166 0.07
167 0.12
168 0.17
169 0.21
170 0.24
171 0.32
172 0.38
173 0.44
174 0.46
175 0.44
176 0.45
177 0.43
178 0.45
179 0.45
180 0.47
181 0.47
182 0.46
183 0.45
184 0.39
185 0.39
186 0.35
187 0.26
188 0.21
189 0.13
190 0.11
191 0.1
192 0.09
193 0.07
194 0.06
195 0.05
196 0.03
197 0.03
198 0.02
199 0.03
200 0.04
201 0.05
202 0.07
203 0.09
204 0.09
205 0.13
206 0.17
207 0.21
208 0.21
209 0.27
210 0.27
211 0.27
212 0.28
213 0.27
214 0.23
215 0.2
216 0.19
217 0.12
218 0.11
219 0.1
220 0.11
221 0.1
222 0.1
223 0.12
224 0.12
225 0.15
226 0.17
227 0.16
228 0.16
229 0.2
230 0.2
231 0.18
232 0.17
233 0.13
234 0.12
235 0.13
236 0.11
237 0.06
238 0.07
239 0.07
240 0.07
241 0.07
242 0.05
243 0.05
244 0.05
245 0.05
246 0.03
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.05
271 0.05
272 0.05
273 0.05
274 0.04
275 0.04
276 0.03
277 0.03
278 0.03
279 0.03
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.03
287 0.03
288 0.03
289 0.04
290 0.04
291 0.04
292 0.04
293 0.05
294 0.05
295 0.05
296 0.05
297 0.06
298 0.07
299 0.07
300 0.08
301 0.09
302 0.09
303 0.09
304 0.1
305 0.1
306 0.09
307 0.08
308 0.08
309 0.08
310 0.09
311 0.09
312 0.07
313 0.07
314 0.07
315 0.07
316 0.06
317 0.05
318 0.04
319 0.04
320 0.04
321 0.03
322 0.03
323 0.03
324 0.03
325 0.02
326 0.02
327 0.03
328 0.02
329 0.03
330 0.03
331 0.04
332 0.04
333 0.05
334 0.05
335 0.06
336 0.06
337 0.07
338 0.07
339 0.07
340 0.06
341 0.06
342 0.05
343 0.04
344 0.04
345 0.03
346 0.03
347 0.03
348 0.04
349 0.04
350 0.04
351 0.05
352 0.05
353 0.05
354 0.04
355 0.04
356 0.05
357 0.05
358 0.05
359 0.05
360 0.06
361 0.06
362 0.06
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.07
369 0.1
370 0.1
371 0.1
372 0.12
373 0.12
374 0.11
375 0.11
376 0.1
377 0.07
378 0.07
379 0.07
380 0.05
381 0.05
382 0.06
383 0.06
384 0.07
385 0.09
386 0.15
387 0.23
388 0.25
389 0.3
390 0.35
391 0.36
392 0.35
393 0.4
394 0.4
395 0.33
396 0.35
397 0.31
398 0.27
399 0.26
400 0.25
401 0.19
402 0.15
403 0.18
404 0.16
405 0.19
406 0.19
407 0.22
408 0.27
409 0.33
410 0.36
411 0.35
412 0.34
413 0.32
414 0.33
415 0.31
416 0.26
417 0.19
418 0.14
419 0.11
420 0.09
421 0.09
422 0.11
423 0.18
424 0.21
425 0.22
426 0.24
427 0.25
428 0.27
429 0.33
430 0.36
431 0.31
432 0.28
433 0.28
434 0.26
435 0.25
436 0.23
437 0.16
438 0.08
439 0.05
440 0.04
441 0.04
442 0.04
443 0.04
444 0.04
445 0.04
446 0.04
447 0.04
448 0.04
449 0.05
450 0.05
451 0.05
452 0.05
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.05
459 0.05
460 0.05
461 0.06
462 0.09
463 0.1
464 0.1
465 0.1
466 0.11
467 0.1
468 0.1
469 0.1
470 0.07
471 0.07
472 0.07
473 0.06
474 0.05
475 0.06
476 0.06
477 0.06
478 0.08
479 0.08
480 0.1
481 0.1
482 0.11
483 0.11
484 0.14
485 0.16
486 0.15
487 0.16
488 0.16
489 0.16
490 0.16
491 0.18
492 0.15
493 0.12
494 0.18
495 0.17
496 0.18
497 0.19
498 0.19
499 0.2
500 0.2
501 0.19
502 0.13
503 0.15
504 0.14
505 0.13
506 0.12
507 0.12
508 0.12
509 0.14
510 0.14
511 0.12
512 0.11
513 0.12
514 0.13
515 0.13
516 0.15
517 0.14
518 0.13
519 0.13
520 0.14
521 0.12
522 0.12
523 0.18
524 0.17
525 0.18
526 0.2
527 0.23
528 0.23
529 0.26
530 0.27
531 0.21
532 0.26
533 0.26
534 0.25
535 0.23
536 0.23
537 0.19
538 0.21
539 0.2
540 0.14
541 0.13
542 0.13
543 0.14
544 0.18
545 0.19
546 0.23
547 0.3
548 0.35
549 0.42
550 0.5
551 0.53
552 0.58
553 0.66
554 0.69
555 0.72
556 0.77
557 0.79
558 0.81
559 0.84
560 0.79
561 0.73
562 0.72
563 0.71
564 0.69
565 0.67
566 0.66
567 0.65
568 0.67
569 0.67
570 0.64