Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YY30

Protein Details
Accession G2YY30    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
210-243SSSNSNSKSKKTKRETQEKKTKSKSKKAKSKSKNHydrophilic
NLS Segment(s)
PositionSequence
217-243KSKKTKRETQEKKTKSKSKKAKSKSKN
Subcellular Location(s) nucl 21.5, mito_nucl 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MDPTKILSLLEQLDDDIDDIEDTVAPLIQKTIPEFASKLPLLDKAKLYTLVTYAIESILFSYLRLNGVNAREHPVFTELTRMKQYFEKIKVTENPPATAAERNLKLDKGAAGRFIKAGLSGNDKYDLQRAEQLAKERAKSHIRFEELSKKRKVGEEATDSNKAESKTSDESDGSGSSSGSSNEPAPAAHKSKKSKTAKVAATPVEPTEDSSSNSNSKSKKTKRETQEKKTKSKSKKAKSKSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.08
5 0.06
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.07
14 0.08
15 0.09
16 0.11
17 0.13
18 0.16
19 0.16
20 0.18
21 0.19
22 0.19
23 0.25
24 0.24
25 0.23
26 0.21
27 0.27
28 0.28
29 0.31
30 0.32
31 0.27
32 0.29
33 0.3
34 0.29
35 0.23
36 0.21
37 0.19
38 0.17
39 0.15
40 0.13
41 0.11
42 0.1
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.1
51 0.1
52 0.1
53 0.13
54 0.16
55 0.19
56 0.19
57 0.24
58 0.23
59 0.23
60 0.23
61 0.21
62 0.19
63 0.16
64 0.24
65 0.19
66 0.22
67 0.27
68 0.26
69 0.26
70 0.28
71 0.33
72 0.32
73 0.35
74 0.37
75 0.34
76 0.39
77 0.43
78 0.43
79 0.45
80 0.39
81 0.35
82 0.3
83 0.31
84 0.27
85 0.23
86 0.21
87 0.2
88 0.19
89 0.21
90 0.22
91 0.2
92 0.19
93 0.17
94 0.18
95 0.16
96 0.15
97 0.17
98 0.17
99 0.17
100 0.17
101 0.17
102 0.14
103 0.11
104 0.12
105 0.08
106 0.13
107 0.13
108 0.14
109 0.15
110 0.15
111 0.15
112 0.17
113 0.17
114 0.12
115 0.15
116 0.15
117 0.16
118 0.18
119 0.21
120 0.24
121 0.26
122 0.26
123 0.24
124 0.29
125 0.34
126 0.34
127 0.37
128 0.36
129 0.37
130 0.37
131 0.4
132 0.45
133 0.44
134 0.49
135 0.46
136 0.41
137 0.41
138 0.43
139 0.43
140 0.37
141 0.38
142 0.38
143 0.4
144 0.43
145 0.45
146 0.41
147 0.38
148 0.36
149 0.29
150 0.23
151 0.19
152 0.19
153 0.2
154 0.21
155 0.22
156 0.2
157 0.2
158 0.21
159 0.2
160 0.16
161 0.12
162 0.11
163 0.09
164 0.09
165 0.1
166 0.09
167 0.1
168 0.1
169 0.1
170 0.11
171 0.1
172 0.12
173 0.17
174 0.22
175 0.26
176 0.34
177 0.41
178 0.48
179 0.59
180 0.64
181 0.67
182 0.7
183 0.74
184 0.73
185 0.71
186 0.71
187 0.63
188 0.58
189 0.51
190 0.42
191 0.36
192 0.3
193 0.26
194 0.24
195 0.22
196 0.22
197 0.23
198 0.26
199 0.26
200 0.29
201 0.32
202 0.3
203 0.37
204 0.46
205 0.52
206 0.59
207 0.65
208 0.73
209 0.78
210 0.86
211 0.89
212 0.89
213 0.91
214 0.89
215 0.91
216 0.91
217 0.91
218 0.9
219 0.9
220 0.9
221 0.9
222 0.92
223 0.92