Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YD94

Protein Details
Accession G2YD94    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-55GYYVGSKRKNAKKKNDEPTSEHydrophilic
NLS Segment(s)
PositionSequence
42-48RKNAKKK
Subcellular Location(s) nucl 12.5, mito_nucl 10.5, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MTTLTQFTVFPKLSNDLKAMIWDIASQEPRRIQFGYYVGSKRKNAKKKNDEPTSERDKIFSGKHPDYPHPWRLLATGGLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.23
4 0.23
5 0.23
6 0.21
7 0.16
8 0.14
9 0.12
10 0.12
11 0.13
12 0.17
13 0.16
14 0.18
15 0.2
16 0.21
17 0.24
18 0.23
19 0.19
20 0.19
21 0.2
22 0.2
23 0.21
24 0.23
25 0.24
26 0.27
27 0.29
28 0.34
29 0.41
30 0.48
31 0.54
32 0.62
33 0.69
34 0.75
35 0.83
36 0.83
37 0.8
38 0.75
39 0.74
40 0.72
41 0.65
42 0.55
43 0.46
44 0.39
45 0.37
46 0.35
47 0.36
48 0.36
49 0.35
50 0.41
51 0.44
52 0.48
53 0.52
54 0.57
55 0.56
56 0.51
57 0.49
58 0.44
59 0.41
60 0.38