Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YF23

Protein Details
Accession G2YF23    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-94LYYEQRRVRTPKSRSRSRSRLISNRRHydrophilic
NLS Segment(s)
PositionSequence
77-94RTPKSRSRSRSRLISNRR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAMNDTESESSYHLFKCRPEAYGALRISRIDEQSLSAYVSGRSLVSDLGVIFEPLIAMVAATVTTRYTLYYEQRRVRTPKSRSRSRSRLISNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.27
4 0.28
5 0.28
6 0.29
7 0.31
8 0.33
9 0.39
10 0.39
11 0.32
12 0.31
13 0.29
14 0.29
15 0.28
16 0.23
17 0.16
18 0.15
19 0.15
20 0.15
21 0.16
22 0.13
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.07
55 0.11
56 0.19
57 0.28
58 0.37
59 0.43
60 0.48
61 0.55
62 0.59
63 0.65
64 0.67
65 0.67
66 0.7
67 0.72
68 0.78
69 0.8
70 0.85
71 0.86
72 0.83
73 0.84
74 0.84