Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XZ59

Protein Details
Accession G2XZ59   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTFVKFKRKRKATPWMESRKIKCTHydrophilic
NLS Segment(s)
PositionSequence
7-11KRKRK
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR013150  TFIIB_cyclin  
Gene Ontology GO:0017025  F:TBP-class protein binding  
Pfam View protein in Pfam  
PF00382  TFIIB  
Amino Acid Sequences MTFVKFKRKRKATPWMESRKIKCTYSRVWRKASGRSLRPTLGQNKGIRGGEFPVEESSPFHSQHEKAIAIHMVDMPVIQTSPSPEASSRRILHALTPPLFDYTQYMESPLDEPKPFNTQDDYNILPRSTSPFMRPGFSQWNSNVGHTGPEYDTPQHKYRFSDVEGCEKIEKDCQSGNLPANVSNRAKYLWKILSQAAADYNSLRLDETMDKLPAVLVACCIYIACQQCKIPRTFIAIRVFTETSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.87
5 0.82
6 0.8
7 0.74
8 0.67
9 0.63
10 0.6
11 0.6
12 0.63
13 0.69
14 0.68
15 0.69
16 0.74
17 0.72
18 0.74
19 0.74
20 0.73
21 0.7
22 0.7
23 0.69
24 0.62
25 0.6
26 0.58
27 0.56
28 0.53
29 0.53
30 0.48
31 0.47
32 0.5
33 0.48
34 0.41
35 0.35
36 0.3
37 0.26
38 0.24
39 0.21
40 0.18
41 0.17
42 0.17
43 0.16
44 0.19
45 0.19
46 0.2
47 0.2
48 0.22
49 0.23
50 0.27
51 0.3
52 0.26
53 0.23
54 0.24
55 0.24
56 0.19
57 0.2
58 0.15
59 0.11
60 0.1
61 0.09
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.06
68 0.09
69 0.1
70 0.11
71 0.12
72 0.16
73 0.19
74 0.26
75 0.25
76 0.25
77 0.26
78 0.25
79 0.27
80 0.3
81 0.32
82 0.26
83 0.26
84 0.24
85 0.24
86 0.24
87 0.21
88 0.16
89 0.13
90 0.15
91 0.14
92 0.14
93 0.12
94 0.13
95 0.14
96 0.14
97 0.13
98 0.11
99 0.12
100 0.13
101 0.17
102 0.17
103 0.17
104 0.18
105 0.16
106 0.18
107 0.21
108 0.2
109 0.19
110 0.19
111 0.18
112 0.15
113 0.14
114 0.16
115 0.16
116 0.15
117 0.15
118 0.2
119 0.21
120 0.23
121 0.23
122 0.22
123 0.28
124 0.28
125 0.3
126 0.24
127 0.29
128 0.28
129 0.28
130 0.25
131 0.17
132 0.17
133 0.14
134 0.15
135 0.1
136 0.11
137 0.12
138 0.14
139 0.17
140 0.21
141 0.27
142 0.28
143 0.3
144 0.31
145 0.33
146 0.34
147 0.33
148 0.36
149 0.33
150 0.38
151 0.37
152 0.36
153 0.33
154 0.3
155 0.28
156 0.26
157 0.25
158 0.19
159 0.19
160 0.2
161 0.23
162 0.27
163 0.28
164 0.26
165 0.25
166 0.26
167 0.27
168 0.31
169 0.29
170 0.25
171 0.24
172 0.23
173 0.24
174 0.22
175 0.27
176 0.26
177 0.27
178 0.29
179 0.29
180 0.32
181 0.3
182 0.3
183 0.24
184 0.21
185 0.19
186 0.16
187 0.16
188 0.12
189 0.12
190 0.11
191 0.09
192 0.11
193 0.14
194 0.16
195 0.19
196 0.19
197 0.18
198 0.18
199 0.18
200 0.17
201 0.15
202 0.12
203 0.1
204 0.1
205 0.1
206 0.1
207 0.1
208 0.09
209 0.13
210 0.19
211 0.21
212 0.24
213 0.28
214 0.35
215 0.42
216 0.44
217 0.43
218 0.41
219 0.47
220 0.47
221 0.51
222 0.53
223 0.49
224 0.47
225 0.49
226 0.45