Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YXH8

Protein Details
Accession G2YXH8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-110ALASANKGKKKPKTVKQGQNTLVSVHydrophilic
NLS Segment(s)
PositionSequence
90-98ANKGKKKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAKQHGTTNHHCIRASEGNCRQSKTPGNKKYCSVHMQYCKEPGCEMGLPYGLRQFCKVCEGKADREEKLKQETDEKELKKKEASDALASANKGKKKPKTVKQGQNTLVSVAEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.46
4 0.47
5 0.52
6 0.54
7 0.56
8 0.5
9 0.47
10 0.54
11 0.55
12 0.58
13 0.59
14 0.64
15 0.65
16 0.68
17 0.67
18 0.64
19 0.59
20 0.53
21 0.52
22 0.54
23 0.55
24 0.53
25 0.54
26 0.49
27 0.44
28 0.39
29 0.3
30 0.25
31 0.21
32 0.19
33 0.13
34 0.14
35 0.13
36 0.13
37 0.16
38 0.13
39 0.13
40 0.14
41 0.13
42 0.12
43 0.18
44 0.18
45 0.15
46 0.22
47 0.25
48 0.28
49 0.33
50 0.36
51 0.31
52 0.37
53 0.39
54 0.34
55 0.37
56 0.35
57 0.29
58 0.33
59 0.34
60 0.34
61 0.4
62 0.4
63 0.42
64 0.42
65 0.44
66 0.4
67 0.39
68 0.38
69 0.37
70 0.38
71 0.32
72 0.31
73 0.33
74 0.32
75 0.31
76 0.31
77 0.3
78 0.31
79 0.34
80 0.41
81 0.46
82 0.54
83 0.64
84 0.69
85 0.75
86 0.81
87 0.86
88 0.88
89 0.89
90 0.84
91 0.8
92 0.72
93 0.61