Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y8P9

Protein Details
Accession G2Y8P9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-32SLSAKDDKKPKLPRIGKNQRIQKRPLHydrophilic
NLS Segment(s)
PositionSequence
14-30KKPKLPRIGKNQRIQKR
Subcellular Location(s) nucl 15.5, mito_nucl 13.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
IPR020241  RNase_P/MRP_Pop7_fungi  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MARTLPSLSAKDDKKPKLPRIGKNQRIQKRPLLHPAIASPRSSSEKVVYVSDKSQFIAIVKRVRKYLDGAEFRAGPTVLPSTDRELMREIEEGIKTSRMERKSGSGNGEEVVMKGTGKAIEKTLMLAHWWQQQEGVRVVVRTKSVATVDDIVGIDNKDDDMEESESRVRRVSVLEVAVSYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.69
4 0.72
5 0.79
6 0.79
7 0.81
8 0.86
9 0.85
10 0.85
11 0.87
12 0.85
13 0.83
14 0.79
15 0.76
16 0.74
17 0.71
18 0.72
19 0.67
20 0.59
21 0.54
22 0.54
23 0.54
24 0.47
25 0.41
26 0.32
27 0.3
28 0.34
29 0.33
30 0.3
31 0.23
32 0.26
33 0.27
34 0.28
35 0.26
36 0.23
37 0.25
38 0.26
39 0.24
40 0.2
41 0.19
42 0.16
43 0.16
44 0.18
45 0.2
46 0.25
47 0.28
48 0.3
49 0.31
50 0.32
51 0.32
52 0.3
53 0.32
54 0.33
55 0.33
56 0.33
57 0.33
58 0.32
59 0.31
60 0.29
61 0.22
62 0.12
63 0.1
64 0.09
65 0.08
66 0.09
67 0.1
68 0.13
69 0.18
70 0.18
71 0.18
72 0.18
73 0.19
74 0.18
75 0.18
76 0.14
77 0.12
78 0.12
79 0.12
80 0.11
81 0.12
82 0.11
83 0.13
84 0.18
85 0.17
86 0.19
87 0.19
88 0.22
89 0.26
90 0.29
91 0.29
92 0.24
93 0.24
94 0.22
95 0.22
96 0.18
97 0.13
98 0.11
99 0.08
100 0.07
101 0.06
102 0.07
103 0.08
104 0.09
105 0.1
106 0.1
107 0.12
108 0.12
109 0.13
110 0.13
111 0.11
112 0.1
113 0.11
114 0.13
115 0.17
116 0.18
117 0.17
118 0.19
119 0.22
120 0.25
121 0.25
122 0.24
123 0.19
124 0.2
125 0.21
126 0.21
127 0.19
128 0.16
129 0.15
130 0.16
131 0.16
132 0.16
133 0.17
134 0.18
135 0.17
136 0.18
137 0.17
138 0.15
139 0.15
140 0.14
141 0.11
142 0.09
143 0.09
144 0.07
145 0.07
146 0.08
147 0.1
148 0.14
149 0.14
150 0.16
151 0.22
152 0.24
153 0.25
154 0.25
155 0.22
156 0.2
157 0.22
158 0.24
159 0.24
160 0.24
161 0.24